Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06266
Gene name
Locationscaffold_07:1737595..1738868
Strand+
Gene length (bp)1273
Transcript length (bp)1146
Coding sequence length (bp)1146
Protein length (aa) 382

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00650 CRAL_TRIO CRAL/TRIO domain 1.2E-22 109 286
PF03765 CRAL_TRIO_N CRAL/TRIO, N-terminal domain 5.0E-09 35 76

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Golgi apparatus Nuclear localization signal|Nuclear export signal 0.6765 0.3868 0.1119 0.0412 0.2145 0.0902 0.2343 0.4791 0.6923 0.0043

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6505
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06266 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1709
Ophiocordyceps kimflemingae Ophio5|4670
Ophiocordyceps subramaniannii Hirsu2|10892

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06266
MSAIVSPPTGLVPEYPRGHVGHLTAEQTEALDSFKALLEERDMWQRGPPASHDDGTLLRFLRARQWVPDKAIEQF
ASSVSWLTTADVNRLRSTMEVSQWQQSRASVPVWTGRRDRRGQPIYYVDCGSVNEKAWTEKGQASAVRAFAASRA
NSEVTASMLTSVLHLEMMNHVFNPMCSRTTDRLHPEVPVTMATYVADIGQLSLRRFWTVKNHVFSLLTSISVLFP
ETASHIFILNAPSYVGIMWNWVRSWLDPVTASKVVILKAHEVKPALEAFIDPTNIPVRYGGTLDCDFSDGPVLDD
SLRAVVDWEPSFEGLPAGPLTVETDGDLLVCYTSGFEDGKPRRQKVFAMPAQVGSSQNSIEVVDEKNASGCLVVS
AASVEA*
Coding >Ophcf2|06266
ATGTCCGCAATCGTCAGCCCGCCAACCGGCCTCGTGCCCGAGTATCCCCGTGGCCATGTCGGACACCTGACTGCC
GAGCAGACGGAGGCTCTGGATAGCTTCAAGGCTTTGCTGGAGGAGCGGGACATGTGGCAGCGCGGTCCGCCGGCT
TCGCACGATGATGGCACGCTTCTCCGCTTTCTCCGAGCTCGGCAGTGGGTGCCTGATAAGGCGATTGAGCAGTTC
GCCAGCAGTGTTTCCTGGTTGACGACCGCCGACGTCAACAGACTGCGATCCACGATGGAAGTATCGCAATGGCAG
CAATCGCGCGCCTCGGTCCCCGTCTGGACCGGTCGACGAGACAGACGCGGTCAGCCCATCTACTACGTCGACTGC
GGCTCCGTCAATGAGAAAGCCTGGACGGAAAAGGGTCAGGCCAGTGCGGTGCGGGCTTTTGCAGCTTCCAGGGCA
AACTCGGAGGTGACGGCTTCGATGCTGACGTCGGTGCTTCATCTCGAAATGATGAACCACGTCTTCAACCCCATG
TGTTCGCGCACCACGGATAGGCTTCATCCAGAGGTGCCCGTCACAATGGCGACGTACGTAGCCGACATCGGCCAA
CTATCGCTCCGCAGGTTCTGGACGGTAAAGAACCACGTCTTCTCGCTACTGACGAGCATCTCGGTCCTCTTCCCG
GAGACGGCATCGCACATCTTTATCCTCAACGCGCCCTCGTACGTCGGCATCATGTGGAACTGGGTGCGCTCCTGG
CTCGATCCCGTCACAGCCTCCAAGGTCGTCATCCTCAAGGCCCACGAGGTTAAGCCCGCGCTCGAGGCCTTTATC
GATCCGACTAACATCCCCGTTCGCTATGGAGGTACTCTCGACTGTGATTTCTCCGACGGGCCTGTGCTCGACGAT
AGTCTGCGCGCCGTCGTCGACTGGGAGCCTTCCTTCGAGGGCCTCCCTGCTGGGCCGCTTACGGTCGAGACGGAT
GGCGATCTTCTCGTTTGCTACACCTCCGGGTTCGAGGATGGCAAGCCACGGCGGCAAAAGGTCTTTGCCATGCCA
GCGCAGGTCGGATCGTCACAAAACTCGATCGAGGTGGTGGACGAGAAGAACGCTTCCGGATGTCTCGTCGTCTCA
GCAGCCTCCGTAGAGGCGTAG
Transcript >Ophcf2|06266
ATGTCCGCAATCGTCAGCCCGCCAACCGGCCTCGTGCCCGAGTATCCCCGTGGCCATGTCGGACACCTGACTGCC
GAGCAGACGGAGGCTCTGGATAGCTTCAAGGCTTTGCTGGAGGAGCGGGACATGTGGCAGCGCGGTCCGCCGGCT
TCGCACGATGATGGCACGCTTCTCCGCTTTCTCCGAGCTCGGCAGTGGGTGCCTGATAAGGCGATTGAGCAGTTC
GCCAGCAGTGTTTCCTGGTTGACGACCGCCGACGTCAACAGACTGCGATCCACGATGGAAGTATCGCAATGGCAG
CAATCGCGCGCCTCGGTCCCCGTCTGGACCGGTCGACGAGACAGACGCGGTCAGCCCATCTACTACGTCGACTGC
GGCTCCGTCAATGAGAAAGCCTGGACGGAAAAGGGTCAGGCCAGTGCGGTGCGGGCTTTTGCAGCTTCCAGGGCA
AACTCGGAGGTGACGGCTTCGATGCTGACGTCGGTGCTTCATCTCGAAATGATGAACCACGTCTTCAACCCCATG
TGTTCGCGCACCACGGATAGGCTTCATCCAGAGGTGCCCGTCACAATGGCGACGTACGTAGCCGACATCGGCCAA
CTATCGCTCCGCAGGTTCTGGACGGTAAAGAACCACGTCTTCTCGCTACTGACGAGCATCTCGGTCCTCTTCCCG
GAGACGGCATCGCACATCTTTATCCTCAACGCGCCCTCGTACGTCGGCATCATGTGGAACTGGGTGCGCTCCTGG
CTCGATCCCGTCACAGCCTCCAAGGTCGTCATCCTCAAGGCCCACGAGGTTAAGCCCGCGCTCGAGGCCTTTATC
GATCCGACTAACATCCCCGTTCGCTATGGAGGTACTCTCGACTGTGATTTCTCCGACGGGCCTGTGCTCGACGAT
AGTCTGCGCGCCGTCGTCGACTGGGAGCCTTCCTTCGAGGGCCTCCCTGCTGGGCCGCTTACGGTCGAGACGGAT
GGCGATCTTCTCGTTTGCTACACCTCCGGGTTCGAGGATGGCAAGCCACGGCGGCAAAAGGTCTTTGCCATGCCA
GCGCAGGTCGGATCGTCACAAAACTCGATCGAGGTGGTGGACGAGAAGAACGCTTCCGGATGTCTCGTCGTCTCA
GCAGCCTCCGTAGAGGCGTAG
Gene >Ophcf2|06266
ATGTCCGCAATCGTCAGCCCGCCAACCGGCCTCGTGCCCGAGTATCCCCGTGGCCATGTCGGACACCTGACTGCC
GAGCAGACGGAGGCTCTGGATAGCTTCAAGGCTTTGCTGGAGGAGCGGGACATGTGGCAGCGCGGTCCGCCGGCT
TCGCACGATGATGGCACGCTTCTGTAGGGACTGCTCCTCTCCTTGTGTGTGTGTGTGTGTGTGTGTGTGTTTCTC
TGGCTCACCGTTTGCAGCCGCTTTCTCCGAGCTCGGCAGTGGGTGCCTGATAAGGCGATTGAGCAGTTCGCCAGC
AGTGTTTCCTGGTTGACGACCGCCGACGTCAACAGACTGCGATCCACGATGGAAGTATCGCAATGGCAGCAATCG
CGCGCCTCGGTTCGTTCTCCCCCGCCCAATCCCGGTCAAGCTATCCGCGCAGCGCTCATCCGTATAGGTCCCCGT
CTGGACCGGTCGACGAGACAGACGCGGTCAGCCCATCTACTACGTCGACTGCGGCTCCGTCAATGAGAAAGCCTG
GACGGAAAAGGGTCAGGCCAGTGCGGTGCGGGCTTTTGCAGCTTCCAGGGCAAACTCGGAGGTGACGGCTTCGAT
GCTGACGTCGGTGCTTCATCTCGAAATGATGAACCACGTCTTCAACCCCATGTGTTCGCGCACCACGGATAGGCT
TCATCCAGAGGTGCCCGTCACAATGGCGACGTACGTAGCCGACATCGGCCAACTATCGCTCCGCAGGTTCTGGAC
GGTAAAGAACCACGTCTTCTCGCTACTGACGAGCATCTCGGTCCTCTTCCCGGAGACGGCATCGCACATCTTTAT
CCTCAACGCGCCCTCGTACGTCGGCATCATGTGGAACTGGGTGCGCTCCTGGCTCGATCCCGTCACAGCCTCCAA
GGTCGTCATCCTCAAGGCCCACGAGGTTAAGCCCGCGCTCGAGGCCTTTATCGATCCGACTAACATCCCCGTTCG
CTATGGAGGTACTCTCGACTGTGATTTCTCCGACGGGCCTGTGCTCGACGATAGTCTGCGCGCCGTCGTCGACTG
GGAGCCTTCCTTCGAGGGCCTCCCTGCTGGGCCGCTTACGGTCGAGACGGATGGCGATCTTCTCGTTTGCTACAC
CTCCGGGTTCGAGGATGGCAAGCCACGGCGGCAAAAGGTCTTTGCCATGCCAGCGCAGGTCGGATCGTCACAAAA
CTCGATCGAGGTGGTGGACGAGAAGAACGCTTCCGGATGTCTCGTCGTCTCAGCAGCCTCCGTAGAGGCGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail