Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06264
Gene name
Locationscaffold_07:1727286..1729094
Strand-
Gene length (bp)1808
Transcript length (bp)1692
Coding sequence length (bp)1692
Protein length (aa) 564

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06687 SUR7 SUR7/PalI family 1.0E-13 9 163

GO

GO Term Description Terminal node
GO:0005886 plasma membrane Yes
GO:0005575 cellular_component No
GO:0016020 membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 7 29 22
2 82 104 22
3 117 139 22
4 149 171 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 80.84 45.88 115.80
Alive In ants, during behavior modification 6.43 2.15 10.71
Dead In ants, recently dead 6.43 2.33 10.53

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.998205 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06264
MFRPSTPLSVLLLAAFALLLATTISVPIVKAIPLASFKDVNFGALGFCKGDQCSLTLGLDTAALLDNENQAFAVP
TSTRNVISFALIIHPIAAALALAITIMAIASHLRPLSHSTRYLLILFVLVFLTFLASLAAFLVDILLFLPHLQFG
AFLTLAATIVLGISGIASCAMRRAVVSRLAHKRRIEENAEMSGENYHLGSISKPSFTSSTEPTLPVIGTVMSTVD
SKPQFASFEYSNKADMADDMSPSSPGPPQYLASNNMYGDRPPVRAAAMGPLRGGGGMPTRGRGGFGSPPGRGGYP
VPTRGGYGSPPSSRGGYGSPSPSRGGYGSPPPTRGGYGPTGRGGVVGLPGRVSPHEGGPGPPRAAIGARGGRGGA
QGFGTAARPYDASPVYGQGPVRSRSNSPERMRYGSPPRADSPPSRGRVASMESTYSQDDGFMPARTGWNDGPATR
EPDDFDVYSLYENGPYDDGEPMPRTRSPAESDRSGFTSISQRSVNPRWRGKAQPPRRPSNASLVPRGLVPQKPLR
RPDVLLDNPDFSLGGGGGGARRGGMGLTPGSAYPTTAY*
Coding >Ophcf2|06264
ATGTTTCGTCCGTCGACGCCCCTGTCGGTGCTGCTGCTCGCCGCCTTCGCCTTGCTGCTCGCGACCACCATCTCC
GTTCCCATCGTCAAGGCTATTCCTCTCGCCTCGTTCAAAGACGTCAACTTTGGCGCCTTGGGCTTCTGCAAAGGC
GACCAATGTAGCCTGACCCTCGGCTTGGACACGGCCGCACTTCTGGACAATGAGAACCAGGCCTTTGCCGTGCCC
ACCAGCACGCGCAATGTCATCTCATTCGCCCTCATCATACATCCCATCGCCGCCGCCCTCGCCCTCGCCATCACC
ATCATGGCCATCGCCTCTCACCTCCGCCCCCTATCTCACTCGACCCGATACTTACTCATCCTCTTCGTCCTCGTC
TTTCTCACCTTTCTCGCCTCCTTGGCCGCCTTTTTGGTCGACATTCTCCTCTTCTTGCCACATCTGCAGTTCGGA
GCTTTCCTGACCCTGGCCGCAACCATTGTGCTCGGAATAAGCGGCATCGCCTCTTGTGCCATGCGACGTGCTGTC
GTCAGCCGCTTGGCTCACAAACGGCGCATCGAAGAAAATGCCGAAATGAGCGGCGAGAACTACCACCTTGGCTCC
ATATCGAAACCGTCCTTTACGTCCTCAACGGAACCCACGCTGCCCGTCATTGGCACAGTCATGTCGACTGTCGAC
AGCAAGCCCCAATTTGCCTCCTTCGAGTACAGCAATAAGGCCGACATGGCCGATGACATGTCGCCCTCGTCTCCC
GGACCGCCCCAGTATCTCGCCTCCAACAACATGTACGGAGACCGTCCGCCGGTCAGGGCCGCGGCAATGGGGCCT
CTCCGAGGCGGCGGCGGAATGCCAACCCGCGGTAGGGGAGGGTTTGGCTCGCCGCCTGGTCGGGGCGGGTATCCG
GTTCCTACCAGGGGTGGCTACGGCTCTCCCCCATCCTCTCGGGGAGGATACGGCTCTCCCTCACCCTCTCGAGGA
GGCTACGGCTCTCCTCCACCCACCAGGGGAGGCTACGGTCCGACTGGTAGAGGAGGGGTCGTGGGCTTGCCTGGT
AGGGTGAGTCCTCACGAAGGAGGCCCGGGCCCGCCTCGCGCCGCCATTGGGGCACGTGGGGGTCGGGGCGGCGCC
CAGGGTTTCGGTACCGCTGCCAGGCCGTACGATGCTAGTCCGGTGTACGGACAAGGGCCCGTGAGATCCAGAAGC
AACAGCCCGGAGCGAATGAGATACGGCAGCCCCCCGAGAGCGGATTCGCCGCCGTCACGGGGAAGGGTGGCGTCG
ATGGAGAGCACATATAGCCAAGACGACGGTTTCATGCCCGCGCGAACGGGATGGAACGACGGGCCAGCAACTCGA
GAGCCTGATGATTTTGACGTGTACTCGCTGTACGAGAATGGGCCGTACGACGACGGCGAACCGATGCCGAGAACG
CGCAGCCCCGCCGAGTCGGATCGGTCCGGGTTCACGTCGATATCGCAGAGGAGCGTCAACCCGCGTTGGAGAGGC
AAGGCGCAACCGCCTCGACGACCGTCCAACGCGAGCCTGGTGCCCCGTGGACTGGTGCCGCAAAAGCCTCTGAGA
CGGCCGGACGTGCTGCTGGATAATCCGGACTTTTCGTTGGGTGGCGGAGGAGGAGGCGCGCGGCGAGGAGGGATG
GGCTTGACGCCTGGAAGCGCGTATCCGACGACGGCCTACTAA
Transcript >Ophcf2|06264
ATGTTTCGTCCGTCGACGCCCCTGTCGGTGCTGCTGCTCGCCGCCTTCGCCTTGCTGCTCGCGACCACCATCTCC
GTTCCCATCGTCAAGGCTATTCCTCTCGCCTCGTTCAAAGACGTCAACTTTGGCGCCTTGGGCTTCTGCAAAGGC
GACCAATGTAGCCTGACCCTCGGCTTGGACACGGCCGCACTTCTGGACAATGAGAACCAGGCCTTTGCCGTGCCC
ACCAGCACGCGCAATGTCATCTCATTCGCCCTCATCATACATCCCATCGCCGCCGCCCTCGCCCTCGCCATCACC
ATCATGGCCATCGCCTCTCACCTCCGCCCCCTATCTCACTCGACCCGATACTTACTCATCCTCTTCGTCCTCGTC
TTTCTCACCTTTCTCGCCTCCTTGGCCGCCTTTTTGGTCGACATTCTCCTCTTCTTGCCACATCTGCAGTTCGGA
GCTTTCCTGACCCTGGCCGCAACCATTGTGCTCGGAATAAGCGGCATCGCCTCTTGTGCCATGCGACGTGCTGTC
GTCAGCCGCTTGGCTCACAAACGGCGCATCGAAGAAAATGCCGAAATGAGCGGCGAGAACTACCACCTTGGCTCC
ATATCGAAACCGTCCTTTACGTCCTCAACGGAACCCACGCTGCCCGTCATTGGCACAGTCATGTCGACTGTCGAC
AGCAAGCCCCAATTTGCCTCCTTCGAGTACAGCAATAAGGCCGACATGGCCGATGACATGTCGCCCTCGTCTCCC
GGACCGCCCCAGTATCTCGCCTCCAACAACATGTACGGAGACCGTCCGCCGGTCAGGGCCGCGGCAATGGGGCCT
CTCCGAGGCGGCGGCGGAATGCCAACCCGCGGTAGGGGAGGGTTTGGCTCGCCGCCTGGTCGGGGCGGGTATCCG
GTTCCTACCAGGGGTGGCTACGGCTCTCCCCCATCCTCTCGGGGAGGATACGGCTCTCCCTCACCCTCTCGAGGA
GGCTACGGCTCTCCTCCACCCACCAGGGGAGGCTACGGTCCGACTGGTAGAGGAGGGGTCGTGGGCTTGCCTGGT
AGGGTGAGTCCTCACGAAGGAGGCCCGGGCCCGCCTCGCGCCGCCATTGGGGCACGTGGGGGTCGGGGCGGCGCC
CAGGGTTTCGGTACCGCTGCCAGGCCGTACGATGCTAGTCCGGTGTACGGACAAGGGCCCGTGAGATCCAGAAGC
AACAGCCCGGAGCGAATGAGATACGGCAGCCCCCCGAGAGCGGATTCGCCGCCGTCACGGGGAAGGGTGGCGTCG
ATGGAGAGCACATATAGCCAAGACGACGGTTTCATGCCCGCGCGAACGGGATGGAACGACGGGCCAGCAACTCGA
GAGCCTGATGATTTTGACGTGTACTCGCTGTACGAGAATGGGCCGTACGACGACGGCGAACCGATGCCGAGAACG
CGCAGCCCCGCCGAGTCGGATCGGTCCGGGTTCACGTCGATATCGCAGAGGAGCGTCAACCCGCGTTGGAGAGGC
AAGGCGCAACCGCCTCGACGACCGTCCAACGCGAGCCTGGTGCCCCGTGGACTGGTGCCGCAAAAGCCTCTGAGA
CGGCCGGACGTGCTGCTGGATAATCCGGACTTTTCGTTGGGTGGCGGAGGAGGAGGCGCGCGGCGAGGAGGGATG
GGCTTGACGCCTGGAAGCGCGTATCCGACGACGGCCTACTAA
Gene >Ophcf2|06264
ATGTTTCGTCCGTCGACGCCCCTGTCGGTGCTGCTGCTCGCCGCCTTCGCCTTGCTGCTCGCGACCACCATCTCC
GTTCCCATCGTCAAGGCTATTCCTCTCGCCTCGTTCAAAGACGTCAACTTTGGCGCCTTGGGCTTCTGCAAAGGC
GACCAATGTAGCCTGACCCTCGGCTTGGACACGGGTGTGTTTTTCCTCGCGTGCTCTCTCCCGTCCTTCGTCTGA
CCCGCCTCGTTGCAGCCGCACTTCTGGACAATGAGAACCAGGCCTTTGCCGTGCCCACCAGCACGCGCAATGTCA
TCTCATTCGCCCTCATCATACATCCCATCGCCGCCGCCCTCGCCCTCGCCATCACCATCATGGCCATCGCCTCTC
ACCTCCGCCCCCTATCTCACTCGACCCGATACTTACTCATCCTCTTCGTCCTCGTCTTTCTCACCTTTCTCGCCT
CCTTGGCCGCCTTTTTGGTCGACATTCTCCTCTTCTTGCCACATCTGCAGTTCGGAGCTTTCCTGACCCTGGCCG
CAACCATTGTGCTCGGAATAAGCGGCATCGCCTCTTGTGCCATGCGACGTGCTGTCGTCAGCCGCTTGGCTCACA
AACGGCGCATCGAAGAAAATGCCGAAATGAGCGGCGAGAACTACCACCTTGGCTCCATATCGAAACCGTCCTTTA
CGTCCTCAACGGAACCCACGCTGCCCGTCATTGGCACAGTCATGTCGACTGTCGACAGCAAGCCCCAATTTGCCT
CCTTCGAGTACAGCAATAAGGCCGACATGGCCGATGACATGTCGCCCTCGTCTCCCGGACCGCCCCAGTATCTCG
CCTCCAACAACATGTACGGAGACCGTCCGCCGGTCAGGGCCGCGGCAATGGGGCCTCTCCGAGGCGGCGGCGGAA
TGCCAACCCGCGGTAGGGGAGGGTTTGGCTCGCCGCCTGGTCGGGGCGGGTATCCGGTTCCTACCAGGGGTGGCT
ACGGCTCTCCCCCATCCTCTCGGGGAGGATACGGCTCTCCCTCACCCTCTCGAGGAGGCTACGGCTCTCCTCCAC
CCACCAGGGGAGGCTACGGTCCGACTGGTAGAGGAGGGGTCGTGGGCTTGCCTGGTAGGGTGAGTCCTCACGAAG
GAGGCCCGGGCCCGCCTCGCGCCGCCATTGGGGCACGTGGGGGTCGGGGCGGCGCCCAGGGTTTCGGTACCGCTG
CCAGGCCGTACGATGCTAGTCCGGTGTACGGACAAGGGCCCGTGAGATCCAGAAGCAACAGCCCGGAGCGAATGA
GATACGGCAGCCCCCCGAGAGCGGATTCGCCGCCGTCACGGGGAAGGGTGGCGTCGATGGAGAGCACATATAGCC
AAGACGAGTAAGCGCACAGCATTCTTTACCTCGAGCTTAGCAGCTACTGACTTGGAATCGTTCACAGCGGTTTCA
TGCCCGCGCGAACGGGATGGAACGACGGGCCAGCAACTCGAGAGCCTGATGATTTTGACGTGTACTCGCTGTACG
AGAATGGGCCGTACGACGACGGCGAACCGATGCCGAGAACGCGCAGCCCCGCCGAGTCGGATCGGTCCGGGTTCA
CGTCGATATCGCAGAGGAGCGTCAACCCGCGTTGGAGAGGCAAGGCGCAACCGCCTCGACGACCGTCCAACGCGA
GCCTGGTGCCCCGTGGACTGGTGCCGCAAAAGCCTCTGAGACGGCCGGACGTGCTGCTGGATAATCCGGACTTTT
CGTTGGGTGGCGGAGGAGGAGGCGCGCGGCGAGGAGGGATGGGCTTGACGCCTGGAAGCGCGTATCCGACGACGG
CCTACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail