Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06257
Gene name
Locationscaffold_07:1705086..1707958
Strand-
Gene length (bp)2872
Transcript length (bp)2817
Coding sequence length (bp)2817
Protein length (aa) 939

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.4E-106 202 714
PF14558 TRP_N ML-like domain 2.1E-38 57 196

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 126 148 22
3 205 227 22
4 234 256 22
5 386 408 22
6 429 451 22
7 466 488 22
8 579 598 19
9 603 622 19
10 634 655 21
11 670 692 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 30.67 17.55 43.79
Alive In ants, during behavior modification 120.76 57.49 184.04
Dead In ants, recently dead 114.12 58.15 170.09

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.811119 no
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06257
MAPRRDSRPWCLVMAFLVTTFFACPAFVLAANDRVYIKGDGIDGVSRQLDVARYPALYTGDFDDCLGDESLFNIT
KFDAAYYADNLTVLFHLDGTSNIRRENLILHISVEAYGENRFNMTYDPCKANIASMCPLNASVPVSAFATIPISP
NDVAGIPSIALGIPDLEGFARLQIFANSTKTEIGCFQAVMTNGNSFSQPRAVASILGILTALAALASFATAAYGL
SVPHMRTHYAHSFSVLIIFETFQSIFFSGALSVNWPSVLPAWWSNFAWSAGIFADRSVHKSLRAFTGTNTDATHV
GGAGSFQINNSGGLLRKIYGRALSGGSPKVYKALTRRAAYNASNPYDYNWNGYPRAPGMPMPGTWPGFAGTLSAV
GVPPAEVFMVALIWLLVVLVAIVAFVVAAKLILDLLRRRKYVKSDGFDYFRSHLGGYVLAALFRTLFIAFFAIMT
LATYQFSLRGRAGPTAMAAVVWIVFLLAVGGASALACHARFSQGKFSVVRDTVRIERGTLFGKMPFIAASRSSQL
GEEERSEKRYLLWTIPFLRVKFTDDDANRATVHRDEAFIKRFGWLTGRYRRTKWWFFSVYVVYLFVRASFVGGGS
RSPLAQVFGLFIFELLALLAIVKTSPFEGNRNTALSIWMLSISKIVTCGLSIAFLPDFSLNRIVATVLGIIIIVV
QGFVAVAVVVLIGLGAVSTCMSLSRNREQFPASMDQTRIRYFVHVDARAPDSPPRPRTKMPASGVTVQATTFDVK
GVRRTPKTDDVEGAPSASASLRRSRANSAGSLPRTGRSHRKSWSSKDLAQWDAEMNRGDIQRSNFSTRSGSSLRL
HGLGAGETHAASGSPARRPPPMTPMLESVESPGWGNLPAQPFAEEKTATRGPDTISDDGVSAVARPVVDEKEGSP
HVSAAEPMPRSPENTTSGDGNAVGAISTDEKMTPRENR*
Coding >Ophcf2|06257
ATGGCGCCTCGCCGTGACTCCAGGCCATGGTGCCTCGTCATGGCCTTCCTCGTCACGACATTCTTCGCCTGCCCC
GCCTTTGTCTTGGCCGCTAATGACAGGGTTTACATCAAGGGCGATGGCATCGACGGTGTCTCACGACAACTCGAC
GTCGCCCGTTACCCAGCTCTCTACACGGGTGACTTTGACGACTGCCTTGGTGACGAGAGTCTCTTCAACATCACC
AAGTTCGACGCTGCCTATTATGCCGATAACCTCACAGTCCTCTTCCACCTCGACGGCACGTCCAATATCCGGCGT
GAGAACCTTATACTGCACATCTCCGTTGAGGCCTATGGAGAGAACCGCTTCAACATGACGTACGACCCGTGCAAG
GCCAACATCGCCAGCATGTGTCCTCTCAACGCCAGCGTCCCGGTATCGGCCTTTGCCACAATTCCCATCTCCCCC
AACGACGTCGCCGGTATTCCCTCCATCGCCCTGGGCATCCCCGACCTCGAGGGTTTCGCCCGTCTGCAGATCTTT
GCCAACTCGACCAAAACCGAGATTGGCTGCTTCCAGGCCGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGG
GCCGTCGCCTCTATCCTCGGCATCTTGACCGCCTTGGCCGCCTTGGCATCCTTTGCTACGGCAGCCTACGGGCTC
AGCGTCCCTCATATGCGCACGCACTACGCCCACTCGTTTTCCGTCCTCATCATCTTCGAGACCTTTCAGTCCATC
TTCTTCTCGGGCGCCCTCTCCGTCAACTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCT
GGTATCTTTGCGGACCGTTCCGTTCACAAGTCGCTGAGAGCCTTCACCGGTACCAACACCGATGCCACCCACGTC
GGCGGCGCGGGCTCCTTTCAGATCAACAACAGCGGCGGCCTGCTGCGCAAAATCTACGGCAGAGCCCTGTCCGGC
GGCTCGCCCAAAGTCTACAAAGCGTTGACTCGCCGGGCTGCGTACAACGCGAGCAACCCCTATGACTACAACTGG
AACGGCTATCCTCGCGCCCCGGGAATGCCCATGCCCGGCACCTGGCCCGGCTTTGCTGGGACGCTGTCTGCCGTC
GGCGTGCCCCCGGCCGAGGTCTTTATGGTGGCCCTGATCTGGCTGCTCGTCGTCTTGGTCGCCATCGTCGCCTTC
GTTGTGGCCGCCAAGCTGATACTCGACCTGTTGAGGAGACGCAAGTACGTCAAGTCAGACGGCTTCGACTACTTT
CGCTCCCATCTGGGCGGCTACGTGCTTGCGGCGCTCTTCCGCACTCTCTTCATCGCCTTCTTCGCCATCATGACC
CTGGCCACGTACCAGTTCTCGCTACGCGGTCGGGCTGGGCCAACCGCCATGGCTGCCGTCGTCTGGATCGTCTTT
CTGCTGGCTGTCGGCGGAGCATCGGCGCTTGCTTGCCATGCCAGATTCAGCCAGGGGAAATTCTCAGTCGTCCGG
GATACGGTGCGCATCGAGCGCGGAACTCTCTTCGGCAAGATGCCATTCATAGCAGCCTCGAGGTCAAGCCAGTTG
GGGGAGGAGGAGAGGTCGGAGAAGCGGTACTTGCTTTGGACTATCCCCTTTTTGCGCGTCAAGTTCACCGACGAC
GACGCCAACAGAGCAACGGTTCACCGCGATGAGGCCTTCATCAAGAGATTTGGCTGGCTCACAGGGCGATATCGA
CGCACCAAGTGGTGGTTCTTCTCCGTCTACGTCGTCTACCTCTTCGTCAGGGCCAGCTTCGTCGGCGGAGGCTCC
CGCAGTCCGCTGGCGCAGGTGTTTGGCCTCTTCATCTTTGAGCTCCTCGCCCTACTGGCCATTGTCAAGACGAGC
CCGTTTGAGGGGAACCGGAACACGGCTCTGTCCATCTGGATGCTATCCATCTCCAAGATTGTCACTTGCGGGTTG
TCCATCGCCTTTCTGCCCGACTTTAGCCTCAACCGCATCGTAGCCACGGTGCTGGGCATCATCATTATCGTCGTC
CAGGGCTTCGTCGCCGTCGCCGTCGTCGTCCTCATCGGCCTGGGCGCCGTCTCAACCTGTATGTCCCTGTCGCGC
AACCGGGAGCAGTTCCCCGCGTCCATGGACCAGACGCGTATCCGTTACTTCGTCCACGTGGATGCCCGCGCGCCC
GATTCTCCCCCAAGGCCAAGGACGAAGATGCCGGCAAGCGGGGTGACGGTACAGGCCACGACCTTTGACGTCAAG
GGCGTCCGACGTACACCCAAGACGGACGACGTCGAGGGCGCCCCCAGCGCGTCCGCCAGCCTCCGTCGCAGCCGG
GCCAACAGCGCCGGAAGCCTACCGCGAACGGGCCGCTCGCACCGCAAATCATGGAGCTCCAAGGACTTGGCTCAG
TGGGACGCCGAGATGAATAGGGGCGACATCCAGCGTTCCAACTTTTCCACCCGCTCCGGCTCCTCGCTTCGCCTC
CACGGACTGGGCGCTGGCGAGACCCATGCCGCCAGCGGTTCGCCAGCTAGGAGGCCGCCTCCCATGACGCCCATG
CTGGAGTCGGTCGAGAGCCCTGGTTGGGGCAACCTCCCCGCGCAGCCGTTTGCCGAGGAGAAGACTGCGACAAGG
GGGCCCGATACCATCTCGGACGATGGGGTATCGGCCGTTGCTCGTCCGGTGGTAGATGAGAAGGAGGGAAGCCCT
CATGTTTCGGCGGCAGAACCCATGCCTCGTTCTCCTGAGAACACGACGTCTGGTGATGGGAATGCCGTCGGCGCG
ATATCAACCGATGAGAAAATGACTCCAAGGGAAAATCGATAG
Transcript >Ophcf2|06257
ATGGCGCCTCGCCGTGACTCCAGGCCATGGTGCCTCGTCATGGCCTTCCTCGTCACGACATTCTTCGCCTGCCCC
GCCTTTGTCTTGGCCGCTAATGACAGGGTTTACATCAAGGGCGATGGCATCGACGGTGTCTCACGACAACTCGAC
GTCGCCCGTTACCCAGCTCTCTACACGGGTGACTTTGACGACTGCCTTGGTGACGAGAGTCTCTTCAACATCACC
AAGTTCGACGCTGCCTATTATGCCGATAACCTCACAGTCCTCTTCCACCTCGACGGCACGTCCAATATCCGGCGT
GAGAACCTTATACTGCACATCTCCGTTGAGGCCTATGGAGAGAACCGCTTCAACATGACGTACGACCCGTGCAAG
GCCAACATCGCCAGCATGTGTCCTCTCAACGCCAGCGTCCCGGTATCGGCCTTTGCCACAATTCCCATCTCCCCC
AACGACGTCGCCGGTATTCCCTCCATCGCCCTGGGCATCCCCGACCTCGAGGGTTTCGCCCGTCTGCAGATCTTT
GCCAACTCGACCAAAACCGAGATTGGCTGCTTCCAGGCCGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGG
GCCGTCGCCTCTATCCTCGGCATCTTGACCGCCTTGGCCGCCTTGGCATCCTTTGCTACGGCAGCCTACGGGCTC
AGCGTCCCTCATATGCGCACGCACTACGCCCACTCGTTTTCCGTCCTCATCATCTTCGAGACCTTTCAGTCCATC
TTCTTCTCGGGCGCCCTCTCCGTCAACTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCT
GGTATCTTTGCGGACCGTTCCGTTCACAAGTCGCTGAGAGCCTTCACCGGTACCAACACCGATGCCACCCACGTC
GGCGGCGCGGGCTCCTTTCAGATCAACAACAGCGGCGGCCTGCTGCGCAAAATCTACGGCAGAGCCCTGTCCGGC
GGCTCGCCCAAAGTCTACAAAGCGTTGACTCGCCGGGCTGCGTACAACGCGAGCAACCCCTATGACTACAACTGG
AACGGCTATCCTCGCGCCCCGGGAATGCCCATGCCCGGCACCTGGCCCGGCTTTGCTGGGACGCTGTCTGCCGTC
GGCGTGCCCCCGGCCGAGGTCTTTATGGTGGCCCTGATCTGGCTGCTCGTCGTCTTGGTCGCCATCGTCGCCTTC
GTTGTGGCCGCCAAGCTGATACTCGACCTGTTGAGGAGACGCAAGTACGTCAAGTCAGACGGCTTCGACTACTTT
CGCTCCCATCTGGGCGGCTACGTGCTTGCGGCGCTCTTCCGCACTCTCTTCATCGCCTTCTTCGCCATCATGACC
CTGGCCACGTACCAGTTCTCGCTACGCGGTCGGGCTGGGCCAACCGCCATGGCTGCCGTCGTCTGGATCGTCTTT
CTGCTGGCTGTCGGCGGAGCATCGGCGCTTGCTTGCCATGCCAGATTCAGCCAGGGGAAATTCTCAGTCGTCCGG
GATACGGTGCGCATCGAGCGCGGAACTCTCTTCGGCAAGATGCCATTCATAGCAGCCTCGAGGTCAAGCCAGTTG
GGGGAGGAGGAGAGGTCGGAGAAGCGGTACTTGCTTTGGACTATCCCCTTTTTGCGCGTCAAGTTCACCGACGAC
GACGCCAACAGAGCAACGGTTCACCGCGATGAGGCCTTCATCAAGAGATTTGGCTGGCTCACAGGGCGATATCGA
CGCACCAAGTGGTGGTTCTTCTCCGTCTACGTCGTCTACCTCTTCGTCAGGGCCAGCTTCGTCGGCGGAGGCTCC
CGCAGTCCGCTGGCGCAGGTGTTTGGCCTCTTCATCTTTGAGCTCCTCGCCCTACTGGCCATTGTCAAGACGAGC
CCGTTTGAGGGGAACCGGAACACGGCTCTGTCCATCTGGATGCTATCCATCTCCAAGATTGTCACTTGCGGGTTG
TCCATCGCCTTTCTGCCCGACTTTAGCCTCAACCGCATCGTAGCCACGGTGCTGGGCATCATCATTATCGTCGTC
CAGGGCTTCGTCGCCGTCGCCGTCGTCGTCCTCATCGGCCTGGGCGCCGTCTCAACCTGTATGTCCCTGTCGCGC
AACCGGGAGCAGTTCCCCGCGTCCATGGACCAGACGCGTATCCGTTACTTCGTCCACGTGGATGCCCGCGCGCCC
GATTCTCCCCCAAGGCCAAGGACGAAGATGCCGGCAAGCGGGGTGACGGTACAGGCCACGACCTTTGACGTCAAG
GGCGTCCGACGTACACCCAAGACGGACGACGTCGAGGGCGCCCCCAGCGCGTCCGCCAGCCTCCGTCGCAGCCGG
GCCAACAGCGCCGGAAGCCTACCGCGAACGGGCCGCTCGCACCGCAAATCATGGAGCTCCAAGGACTTGGCTCAG
TGGGACGCCGAGATGAATAGGGGCGACATCCAGCGTTCCAACTTTTCCACCCGCTCCGGCTCCTCGCTTCGCCTC
CACGGACTGGGCGCTGGCGAGACCCATGCCGCCAGCGGTTCGCCAGCTAGGAGGCCGCCTCCCATGACGCCCATG
CTGGAGTCGGTCGAGAGCCCTGGTTGGGGCAACCTCCCCGCGCAGCCGTTTGCCGAGGAGAAGACTGCGACAAGG
GGGCCCGATACCATCTCGGACGATGGGGTATCGGCCGTTGCTCGTCCGGTGGTAGATGAGAAGGAGGGAAGCCCT
CATGTTTCGGCGGCAGAACCCATGCCTCGTTCTCCTGAGAACACGACGTCTGGTGATGGGAATGCCGTCGGCGCG
ATATCAACCGATGAGAAAATGACTCCAAGGGAAAATCGATAG
Gene >Ophcf2|06257
ATGGCGCCTCGCCGTGACTCCAGGCCATGGTGCCTCGTCATGGCCTTCCTCGTCACGACATTCTTCGCCTGCCCC
GCCTTTGTCTTGGCCGCTAATGACAGGGTTTACATCAAGGGCGATGGCATCGACGGTGTCTCACGACAACTCGAC
GTCGCCCGTTACCCAGCTCTCTACACGGGTGACTTTGACGACTGCCTTGGTGACGAGAGTCTCTTCAACATCACC
AAGTTCGACGCTGCCTATTATGCCGATAACCTCACAGTCCTCTTCCACCTCGACGGCACGTCCAATATCCGGCGT
GAGAACCTTATACGTGCGTTGGTCCCCTTGACAGTAGCCTCCTATCTCTGACCTCTTCTCTCTGATAGTGCACAT
CTCCGTTGAGGCCTATGGAGAGAACCGCTTCAACATGACGTACGACCCGTGCAAGGCCAACATCGCCAGCATGTG
TCCTCTCAACGCCAGCGTCCCGGTATCGGCCTTTGCCACAATTCCCATCTCCCCCAACGACGTCGCCGGTATTCC
CTCCATCGCCCTGGGCATCCCCGACCTCGAGGGTTTCGCCCGTCTGCAGATCTTTGCCAACTCGACCAAAACCGA
GATTGGCTGCTTCCAGGCCGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGGGCCGTCGCCTCTATCCTCGG
CATCTTGACCGCCTTGGCCGCCTTGGCATCCTTTGCTACGGCAGCCTACGGGCTCAGCGTCCCTCATATGCGCAC
GCACTACGCCCACTCGTTTTCCGTCCTCATCATCTTCGAGACCTTTCAGTCCATCTTCTTCTCGGGCGCCCTCTC
CGTCAACTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCTGGTATCTTTGCGGACCGTTC
CGTTCACAAGTCGCTGAGAGCCTTCACCGGTACCAACACCGATGCCACCCACGTCGGCGGCGCGGGCTCCTTTCA
GATCAACAACAGCGGCGGCCTGCTGCGCAAAATCTACGGCAGAGCCCTGTCCGGCGGCTCGCCCAAAGTCTACAA
AGCGTTGACTCGCCGGGCTGCGTACAACGCGAGCAACCCCTATGACTACAACTGGAACGGCTATCCTCGCGCCCC
GGGAATGCCCATGCCCGGCACCTGGCCCGGCTTTGCTGGGACGCTGTCTGCCGTCGGCGTGCCCCCGGCCGAGGT
CTTTATGGTGGCCCTGATCTGGCTGCTCGTCGTCTTGGTCGCCATCGTCGCCTTCGTTGTGGCCGCCAAGCTGAT
ACTCGACCTGTTGAGGAGACGCAAGTACGTCAAGTCAGACGGCTTCGACTACTTTCGCTCCCATCTGGGCGGCTA
CGTGCTTGCGGCGCTCTTCCGCACTCTCTTCATCGCCTTCTTCGCCATCATGACCCTGGCCACGTACCAGTTCTC
GCTACGCGGTCGGGCTGGGCCAACCGCCATGGCTGCCGTCGTCTGGATCGTCTTTCTGCTGGCTGTCGGCGGAGC
ATCGGCGCTTGCTTGCCATGCCAGATTCAGCCAGGGGAAATTCTCAGTCGTCCGGGATACGGTGCGCATCGAGCG
CGGAACTCTCTTCGGCAAGATGCCATTCATAGCAGCCTCGAGGTCAAGCCAGTTGGGGGAGGAGGAGAGGTCGGA
GAAGCGGTACTTGCTTTGGACTATCCCCTTTTTGCGCGTCAAGTTCACCGACGACGACGCCAACAGAGCAACGGT
TCACCGCGATGAGGCCTTCATCAAGAGATTTGGCTGGCTCACAGGGCGATATCGACGCACCAAGTGGTGGTTCTT
CTCCGTCTACGTCGTCTACCTCTTCGTCAGGGCCAGCTTCGTCGGCGGAGGCTCCCGCAGTCCGCTGGCGCAGGT
GTTTGGCCTCTTCATCTTTGAGCTCCTCGCCCTACTGGCCATTGTCAAGACGAGCCCGTTTGAGGGGAACCGGAA
CACGGCTCTGTCCATCTGGATGCTATCCATCTCCAAGATTGTCACTTGCGGGTTGTCCATCGCCTTTCTGCCCGA
CTTTAGCCTCAACCGCATCGTAGCCACGGTGCTGGGCATCATCATTATCGTCGTCCAGGGCTTCGTCGCCGTCGC
CGTCGTCGTCCTCATCGGCCTGGGCGCCGTCTCAACCTGTATGTCCCTGTCGCGCAACCGGGAGCAGTTCCCCGC
GTCCATGGACCAGACGCGTATCCGTTACTTCGTCCACGTGGATGCCCGCGCGCCCGATTCTCCCCCAAGGCCAAG
GACGAAGATGCCGGCAAGCGGGGTGACGGTACAGGCCACGACCTTTGACGTCAAGGGCGTCCGACGTACACCCAA
GACGGACGACGTCGAGGGCGCCCCCAGCGCGTCCGCCAGCCTCCGTCGCAGCCGGGCCAACAGCGCCGGAAGCCT
ACCGCGAACGGGCCGCTCGCACCGCAAATCATGGAGCTCCAAGGACTTGGCTCAGTGGGACGCCGAGATGAATAG
GGGCGACATCCAGCGTTCCAACTTTTCCACCCGCTCCGGCTCCTCGCTTCGCCTCCACGGACTGGGCGCTGGCGA
GACCCATGCCGCCAGCGGTTCGCCAGCTAGGAGGCCGCCTCCCATGACGCCCATGCTGGAGTCGGTCGAGAGCCC
TGGTTGGGGCAACCTCCCCGCGCAGCCGTTTGCCGAGGAGAAGACTGCGACAAGGGGGCCCGATACCATCTCGGA
CGATGGGGTATCGGCCGTTGCTCGTCCGGTGGTAGATGAGAAGGAGGGAAGCCCTCATGTTTCGGCGGCAGAACC
CATGCCTCGTTCTCCTGAGAACACGACGTCTGGTGATGGGAATGCCGTCGGCGCGATATCAACCGATGAGAAAAT
GACTCCAAGGGAAAATCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail