Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06257
Gene name
Locationscaffold_07:1705086..1707958
Strand-
Gene length (bp)2872
Transcript length (bp)2817
Coding sequence length (bp)2817
Protein length (aa) 939

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06011 TRP Transient receptor potential (TRP) ion channel 3.4E-106 202 714
PF14558 TRP_N ML-like domain 2.1E-38 57 196

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22
2 126 148 22
3 205 227 22
4 234 256 22
5 386 408 22
6 429 451 22
7 466 488 22
8 579 598 19
9 603 622 19
10 634 655 21
11 670 692 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06257
MAPRRDSRPWCLVMAFLVTTFFACPAFVLAANDRVYIKGDGIDGVSRQLDVARYPALYTGDFDDCLGDESLFNIT
KFDAAYYADNLTVLFHLDGTSNIRRENLILHISVEAYGENRFNMTYDPCKANIASMCPLNASVPVSAFATIPISP
NDVAGIPSIALGIPDLEGFARLQIFANSTKTEIGCFQAVMTNGNSFSQPRAVASILGILTALAALASFATAAYGL
SVPHMRTHYAHSFSVLIIFETFQSIFFSGALSVNWPSVLPAWWSNFAWSAGIFADRSVHKSLRAFTGTNTDATHV
GGAGSFQINNSGGLLRKIYGRALSGGSPKVYKALTRRAAYNASNPYDYNWNGYPRAPGMPMPGTWPGFAGTLSAV
GVPPAEVFMVALIWLLVVLVAIVAFVVAAKLILDLLRRRKYVKSDGFDYFRSHLGGYVLAALFRTLFIAFFAIMT
LATYQFSLRGRAGPTAMAAVVWIVFLLAVGGASALACHARFSQGKFSVVRDTVRIERGTLFGKMPFIAASRSSQL
GEEERSEKRYLLWTIPFLRVKFTDDDANRATVHRDEAFIKRFGWLTGRYRRTKWWFFSVYVVYLFVRASFVGGGS
RSPLAQVFGLFIFELLALLAIVKTSPFEGNRNTALSIWMLSISKIVTCGLSIAFLPDFSLNRIVATVLGIIIIVV
QGFVAVAVVVLIGLGAVSTCMSLSRNREQFPASMDQTRIRYFVHVDARAPDSPPRPRTKMPASGVTVQATTFDVK
GVRRTPKTDDVEGAPSASASLRRSRANSAGSLPRTGRSHRKSWSSKDLAQWDAEMNRGDIQRSNFSTRSGSSLRL
HGLGAGETHAASGSPARRPPPMTPMLESVESPGWGNLPAQPFAEEKTATRGPDTISDDGVSAVARPVVDEKEGSP
HVSAAEPMPRSPENTTSGDGNAVGAISTDEKMTPRENR*
Coding >Ophcf2|06257
ATGGCGCCTCGCCGTGACTCCAGGCCATGGTGCCTCGTCATGGCCTTCCTCGTCACGACATTCTTCGCCTGCCCC
GCCTTTGTCTTGGCCGCTAATGACAGGGTTTACATCAAGGGCGATGGCATCGACGGTGTCTCACGACAACTCGAC
GTCGCCCGTTACCCAGCTCTCTACACGGGTGACTTTGACGACTGCCTTGGTGACGAGAGTCTCTTCAACATCACC
AAGTTCGACGCTGCCTATTATGCCGATAACCTCACAGTCCTCTTCCACCTCGACGGCACGTCCAATATCCGGCGT
GAGAACCTTATACTGCACATCTCCGTTGAGGCCTATGGAGAGAACCGCTTCAACATGACGTACGACCCGTGCAAG
GCCAACATCGCCAGCATGTGTCCTCTCAACGCCAGCGTCCCGGTATCGGCCTTTGCCACAATTCCCATCTCCCCC
AACGACGTCGCCGGTATTCCCTCCATCGCCCTGGGCATCCCCGACCTCGAGGGTTTCGCCCGTCTGCAGATCTTT
GCCAACTCGACCAAAACCGAGATTGGCTGCTTCCAGGCCGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGG
GCCGTCGCCTCTATCCTCGGCATCTTGACCGCCTTGGCCGCCTTGGCATCCTTTGCTACGGCAGCCTACGGGCTC
AGCGTCCCTCATATGCGCACGCACTACGCCCACTCGTTTTCCGTCCTCATCATCTTCGAGACCTTTCAGTCCATC
TTCTTCTCGGGCGCCCTCTCCGTCAACTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCT
GGTATCTTTGCGGACCGTTCCGTTCACAAGTCGCTGAGAGCCTTCACCGGTACCAACACCGATGCCACCCACGTC
GGCGGCGCGGGCTCCTTTCAGATCAACAACAGCGGCGGCCTGCTGCGCAAAATCTACGGCAGAGCCCTGTCCGGC
GGCTCGCCCAAAGTCTACAAAGCGTTGACTCGCCGGGCTGCGTACAACGCGAGCAACCCCTATGACTACAACTGG
AACGGCTATCCTCGCGCCCCGGGAATGCCCATGCCCGGCACCTGGCCCGGCTTTGCTGGGACGCTGTCTGCCGTC
GGCGTGCCCCCGGCCGAGGTCTTTATGGTGGCCCTGATCTGGCTGCTCGTCGTCTTGGTCGCCATCGTCGCCTTC
GTTGTGGCCGCCAAGCTGATACTCGACCTGTTGAGGAGACGCAAGTACGTCAAGTCAGACGGCTTCGACTACTTT
CGCTCCCATCTGGGCGGCTACGTGCTTGCGGCGCTCTTCCGCACTCTCTTCATCGCCTTCTTCGCCATCATGACC
CTGGCCACGTACCAGTTCTCGCTACGCGGTCGGGCTGGGCCAACCGCCATGGCTGCCGTCGTCTGGATCGTCTTT
CTGCTGGCTGTCGGCGGAGCATCGGCGCTTGCTTGCCATGCCAGATTCAGCCAGGGGAAATTCTCAGTCGTCCGG
GATACGGTGCGCATCGAGCGCGGAACTCTCTTCGGCAAGATGCCATTCATAGCAGCCTCGAGGTCAAGCCAGTTG
GGGGAGGAGGAGAGGTCGGAGAAGCGGTACTTGCTTTGGACTATCCCCTTTTTGCGCGTCAAGTTCACCGACGAC
GACGCCAACAGAGCAACGGTTCACCGCGATGAGGCCTTCATCAAGAGATTTGGCTGGCTCACAGGGCGATATCGA
CGCACCAAGTGGTGGTTCTTCTCCGTCTACGTCGTCTACCTCTTCGTCAGGGCCAGCTTCGTCGGCGGAGGCTCC
CGCAGTCCGCTGGCGCAGGTGTTTGGCCTCTTCATCTTTGAGCTCCTCGCCCTACTGGCCATTGTCAAGACGAGC
CCGTTTGAGGGGAACCGGAACACGGCTCTGTCCATCTGGATGCTATCCATCTCCAAGATTGTCACTTGCGGGTTG
TCCATCGCCTTTCTGCCCGACTTTAGCCTCAACCGCATCGTAGCCACGGTGCTGGGCATCATCATTATCGTCGTC
CAGGGCTTCGTCGCCGTCGCCGTCGTCGTCCTCATCGGCCTGGGCGCCGTCTCAACCTGTATGTCCCTGTCGCGC
AACCGGGAGCAGTTCCCCGCGTCCATGGACCAGACGCGTATCCGTTACTTCGTCCACGTGGATGCCCGCGCGCCC
GATTCTCCCCCAAGGCCAAGGACGAAGATGCCGGCAAGCGGGGTGACGGTACAGGCCACGACCTTTGACGTCAAG
GGCGTCCGACGTACACCCAAGACGGACGACGTCGAGGGCGCCCCCAGCGCGTCCGCCAGCCTCCGTCGCAGCCGG
GCCAACAGCGCCGGAAGCCTACCGCGAACGGGCCGCTCGCACCGCAAATCATGGAGCTCCAAGGACTTGGCTCAG
TGGGACGCCGAGATGAATAGGGGCGACATCCAGCGTTCCAACTTTTCCACCCGCTCCGGCTCCTCGCTTCGCCTC
CACGGACTGGGCGCTGGCGAGACCCATGCCGCCAGCGGTTCGCCAGCTAGGAGGCCGCCTCCCATGACGCCCATG
CTGGAGTCGGTCGAGAGCCCTGGTTGGGGCAACCTCCCCGCGCAGCCGTTTGCCGAGGAGAAGACTGCGACAAGG
GGGCCCGATACCATCTCGGACGATGGGGTATCGGCCGTTGCTCGTCCGGTGGTAGATGAGAAGGAGGGAAGCCCT
CATGTTTCGGCGGCAGAACCCATGCCTCGTTCTCCTGAGAACACGACGTCTGGTGATGGGAATGCCGTCGGCGCG
ATATCAACCGATGAGAAAATGACTCCAAGGGAAAATCGATAG
Transcript >Ophcf2|06257
ATGGCGCCTCGCCGTGACTCCAGGCCATGGTGCCTCGTCATGGCCTTCCTCGTCACGACATTCTTCGCCTGCCCC
GCCTTTGTCTTGGCCGCTAATGACAGGGTTTACATCAAGGGCGATGGCATCGACGGTGTCTCACGACAACTCGAC
GTCGCCCGTTACCCAGCTCTCTACACGGGTGACTTTGACGACTGCCTTGGTGACGAGAGTCTCTTCAACATCACC
AAGTTCGACGCTGCCTATTATGCCGATAACCTCACAGTCCTCTTCCACCTCGACGGCACGTCCAATATCCGGCGT
GAGAACCTTATACTGCACATCTCCGTTGAGGCCTATGGAGAGAACCGCTTCAACATGACGTACGACCCGTGCAAG
GCCAACATCGCCAGCATGTGTCCTCTCAACGCCAGCGTCCCGGTATCGGCCTTTGCCACAATTCCCATCTCCCCC
AACGACGTCGCCGGTATTCCCTCCATCGCCCTGGGCATCCCCGACCTCGAGGGTTTCGCCCGTCTGCAGATCTTT
GCCAACTCGACCAAAACCGAGATTGGCTGCTTCCAGGCCGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGG
GCCGTCGCCTCTATCCTCGGCATCTTGACCGCCTTGGCCGCCTTGGCATCCTTTGCTACGGCAGCCTACGGGCTC
AGCGTCCCTCATATGCGCACGCACTACGCCCACTCGTTTTCCGTCCTCATCATCTTCGAGACCTTTCAGTCCATC
TTCTTCTCGGGCGCCCTCTCCGTCAACTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCT
GGTATCTTTGCGGACCGTTCCGTTCACAAGTCGCTGAGAGCCTTCACCGGTACCAACACCGATGCCACCCACGTC
GGCGGCGCGGGCTCCTTTCAGATCAACAACAGCGGCGGCCTGCTGCGCAAAATCTACGGCAGAGCCCTGTCCGGC
GGCTCGCCCAAAGTCTACAAAGCGTTGACTCGCCGGGCTGCGTACAACGCGAGCAACCCCTATGACTACAACTGG
AACGGCTATCCTCGCGCCCCGGGAATGCCCATGCCCGGCACCTGGCCCGGCTTTGCTGGGACGCTGTCTGCCGTC
GGCGTGCCCCCGGCCGAGGTCTTTATGGTGGCCCTGATCTGGCTGCTCGTCGTCTTGGTCGCCATCGTCGCCTTC
GTTGTGGCCGCCAAGCTGATACTCGACCTGTTGAGGAGACGCAAGTACGTCAAGTCAGACGGCTTCGACTACTTT
CGCTCCCATCTGGGCGGCTACGTGCTTGCGGCGCTCTTCCGCACTCTCTTCATCGCCTTCTTCGCCATCATGACC
CTGGCCACGTACCAGTTCTCGCTACGCGGTCGGGCTGGGCCAACCGCCATGGCTGCCGTCGTCTGGATCGTCTTT
CTGCTGGCTGTCGGCGGAGCATCGGCGCTTGCTTGCCATGCCAGATTCAGCCAGGGGAAATTCTCAGTCGTCCGG
GATACGGTGCGCATCGAGCGCGGAACTCTCTTCGGCAAGATGCCATTCATAGCAGCCTCGAGGTCAAGCCAGTTG
GGGGAGGAGGAGAGGTCGGAGAAGCGGTACTTGCTTTGGACTATCCCCTTTTTGCGCGTCAAGTTCACCGACGAC
GACGCCAACAGAGCAACGGTTCACCGCGATGAGGCCTTCATCAAGAGATTTGGCTGGCTCACAGGGCGATATCGA
CGCACCAAGTGGTGGTTCTTCTCCGTCTACGTCGTCTACCTCTTCGTCAGGGCCAGCTTCGTCGGCGGAGGCTCC
CGCAGTCCGCTGGCGCAGGTGTTTGGCCTCTTCATCTTTGAGCTCCTCGCCCTACTGGCCATTGTCAAGACGAGC
CCGTTTGAGGGGAACCGGAACACGGCTCTGTCCATCTGGATGCTATCCATCTCCAAGATTGTCACTTGCGGGTTG
TCCATCGCCTTTCTGCCCGACTTTAGCCTCAACCGCATCGTAGCCACGGTGCTGGGCATCATCATTATCGTCGTC
CAGGGCTTCGTCGCCGTCGCCGTCGTCGTCCTCATCGGCCTGGGCGCCGTCTCAACCTGTATGTCCCTGTCGCGC
AACCGGGAGCAGTTCCCCGCGTCCATGGACCAGACGCGTATCCGTTACTTCGTCCACGTGGATGCCCGCGCGCCC
GATTCTCCCCCAAGGCCAAGGACGAAGATGCCGGCAAGCGGGGTGACGGTACAGGCCACGACCTTTGACGTCAAG
GGCGTCCGACGTACACCCAAGACGGACGACGTCGAGGGCGCCCCCAGCGCGTCCGCCAGCCTCCGTCGCAGCCGG
GCCAACAGCGCCGGAAGCCTACCGCGAACGGGCCGCTCGCACCGCAAATCATGGAGCTCCAAGGACTTGGCTCAG
TGGGACGCCGAGATGAATAGGGGCGACATCCAGCGTTCCAACTTTTCCACCCGCTCCGGCTCCTCGCTTCGCCTC
CACGGACTGGGCGCTGGCGAGACCCATGCCGCCAGCGGTTCGCCAGCTAGGAGGCCGCCTCCCATGACGCCCATG
CTGGAGTCGGTCGAGAGCCCTGGTTGGGGCAACCTCCCCGCGCAGCCGTTTGCCGAGGAGAAGACTGCGACAAGG
GGGCCCGATACCATCTCGGACGATGGGGTATCGGCCGTTGCTCGTCCGGTGGTAGATGAGAAGGAGGGAAGCCCT
CATGTTTCGGCGGCAGAACCCATGCCTCGTTCTCCTGAGAACACGACGTCTGGTGATGGGAATGCCGTCGGCGCG
ATATCAACCGATGAGAAAATGACTCCAAGGGAAAATCGATAG
Gene >Ophcf2|06257
ATGGCGCCTCGCCGTGACTCCAGGCCATGGTGCCTCGTCATGGCCTTCCTCGTCACGACATTCTTCGCCTGCCCC
GCCTTTGTCTTGGCCGCTAATGACAGGGTTTACATCAAGGGCGATGGCATCGACGGTGTCTCACGACAACTCGAC
GTCGCCCGTTACCCAGCTCTCTACACGGGTGACTTTGACGACTGCCTTGGTGACGAGAGTCTCTTCAACATCACC
AAGTTCGACGCTGCCTATTATGCCGATAACCTCACAGTCCTCTTCCACCTCGACGGCACGTCCAATATCCGGCGT
GAGAACCTTATACGTGCGTTGGTCCCCTTGACAGTAGCCTCCTATCTCTGACCTCTTCTCTCTGATAGTGCACAT
CTCCGTTGAGGCCTATGGAGAGAACCGCTTCAACATGACGTACGACCCGTGCAAGGCCAACATCGCCAGCATGTG
TCCTCTCAACGCCAGCGTCCCGGTATCGGCCTTTGCCACAATTCCCATCTCCCCCAACGACGTCGCCGGTATTCC
CTCCATCGCCCTGGGCATCCCCGACCTCGAGGGTTTCGCCCGTCTGCAGATCTTTGCCAACTCGACCAAAACCGA
GATTGGCTGCTTCCAGGCCGTCATGACCAACGGAAACTCCTTCTCTCAGCCCAGGGCCGTCGCCTCTATCCTCGG
CATCTTGACCGCCTTGGCCGCCTTGGCATCCTTTGCTACGGCAGCCTACGGGCTCAGCGTCCCTCATATGCGCAC
GCACTACGCCCACTCGTTTTCCGTCCTCATCATCTTCGAGACCTTTCAGTCCATCTTCTTCTCGGGCGCCCTCTC
CGTCAACTGGCCGAGCGTGCTGCCCGCCTGGTGGAGCAACTTTGCCTGGTCCGCTGGTATCTTTGCGGACCGTTC
CGTTCACAAGTCGCTGAGAGCCTTCACCGGTACCAACACCGATGCCACCCACGTCGGCGGCGCGGGCTCCTTTCA
GATCAACAACAGCGGCGGCCTGCTGCGCAAAATCTACGGCAGAGCCCTGTCCGGCGGCTCGCCCAAAGTCTACAA
AGCGTTGACTCGCCGGGCTGCGTACAACGCGAGCAACCCCTATGACTACAACTGGAACGGCTATCCTCGCGCCCC
GGGAATGCCCATGCCCGGCACCTGGCCCGGCTTTGCTGGGACGCTGTCTGCCGTCGGCGTGCCCCCGGCCGAGGT
CTTTATGGTGGCCCTGATCTGGCTGCTCGTCGTCTTGGTCGCCATCGTCGCCTTCGTTGTGGCCGCCAAGCTGAT
ACTCGACCTGTTGAGGAGACGCAAGTACGTCAAGTCAGACGGCTTCGACTACTTTCGCTCCCATCTGGGCGGCTA
CGTGCTTGCGGCGCTCTTCCGCACTCTCTTCATCGCCTTCTTCGCCATCATGACCCTGGCCACGTACCAGTTCTC
GCTACGCGGTCGGGCTGGGCCAACCGCCATGGCTGCCGTCGTCTGGATCGTCTTTCTGCTGGCTGTCGGCGGAGC
ATCGGCGCTTGCTTGCCATGCCAGATTCAGCCAGGGGAAATTCTCAGTCGTCCGGGATACGGTGCGCATCGAGCG
CGGAACTCTCTTCGGCAAGATGCCATTCATAGCAGCCTCGAGGTCAAGCCAGTTGGGGGAGGAGGAGAGGTCGGA
GAAGCGGTACTTGCTTTGGACTATCCCCTTTTTGCGCGTCAAGTTCACCGACGACGACGCCAACAGAGCAACGGT
TCACCGCGATGAGGCCTTCATCAAGAGATTTGGCTGGCTCACAGGGCGATATCGACGCACCAAGTGGTGGTTCTT
CTCCGTCTACGTCGTCTACCTCTTCGTCAGGGCCAGCTTCGTCGGCGGAGGCTCCCGCAGTCCGCTGGCGCAGGT
GTTTGGCCTCTTCATCTTTGAGCTCCTCGCCCTACTGGCCATTGTCAAGACGAGCCCGTTTGAGGGGAACCGGAA
CACGGCTCTGTCCATCTGGATGCTATCCATCTCCAAGATTGTCACTTGCGGGTTGTCCATCGCCTTTCTGCCCGA
CTTTAGCCTCAACCGCATCGTAGCCACGGTGCTGGGCATCATCATTATCGTCGTCCAGGGCTTCGTCGCCGTCGC
CGTCGTCGTCCTCATCGGCCTGGGCGCCGTCTCAACCTGTATGTCCCTGTCGCGCAACCGGGAGCAGTTCCCCGC
GTCCATGGACCAGACGCGTATCCGTTACTTCGTCCACGTGGATGCCCGCGCGCCCGATTCTCCCCCAAGGCCAAG
GACGAAGATGCCGGCAAGCGGGGTGACGGTACAGGCCACGACCTTTGACGTCAAGGGCGTCCGACGTACACCCAA
GACGGACGACGTCGAGGGCGCCCCCAGCGCGTCCGCCAGCCTCCGTCGCAGCCGGGCCAACAGCGCCGGAAGCCT
ACCGCGAACGGGCCGCTCGCACCGCAAATCATGGAGCTCCAAGGACTTGGCTCAGTGGGACGCCGAGATGAATAG
GGGCGACATCCAGCGTTCCAACTTTTCCACCCGCTCCGGCTCCTCGCTTCGCCTCCACGGACTGGGCGCTGGCGA
GACCCATGCCGCCAGCGGTTCGCCAGCTAGGAGGCCGCCTCCCATGACGCCCATGCTGGAGTCGGTCGAGAGCCC
TGGTTGGGGCAACCTCCCCGCGCAGCCGTTTGCCGAGGAGAAGACTGCGACAAGGGGGCCCGATACCATCTCGGA
CGATGGGGTATCGGCCGTTGCTCGTCCGGTGGTAGATGAGAAGGAGGGAAGCCCTCATGTTTCGGCGGCAGAACC
CATGCCTCGTTCTCCTGAGAACACGACGTCTGGTGATGGGAATGCCGTCGGCGCGATATCAACCGATGAGAAAAT
GACTCCAAGGGAAAATCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail