Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06256
Gene name
Locationscaffold_07:1702751..1704455
Strand+
Gene length (bp)1704
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01169 UPF0016 Uncharacterized protein family UPF0016 1.9E-20 248 321
PF01169 UPF0016 Uncharacterized protein family UPF0016 2.0E-18 412 484

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 31 0.45

Transmembrane Domains

Domain # Start End Length
1 276 298 22
2 308 325 17
3 397 419 22
4 439 461 22
5 468 490 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 55.49 31.60 79.38
Alive In ants, during behavior modification 69.46 38.74 100.19
Dead In ants, recently dead 45.89 25.52 66.25

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.252020 no
Alive Dead 0.010814 yes
Dead Fungus 0.354164 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06256
MRAHTQPTQPTLSPPLLLLLLLPLLVSSLAGSLKPEPATVSHARVEPRHYVPTKEAPVDGRDGKPHTGPFVEKTD
SDRTGLPPLRGRPEDPTVVDGIKIPKSNDGVMFDRNRERPLEGTTGTEGGVSEKDKARKEKEGQTGERTVGQPKS
PKEQPRLPDSEEKKLQTNGDDRYRPAVEDSSSSGYTGLGKPADIPDIPREDAMPPPKSKTSEAEVPLTGSPRKTS
HKSSDLHADDEDGIIRPFHSFVLSLTMILVSEVGDKTFLVAALMAMKHDRLLVFSAAFGALLVMTVLSALLGHAV
PTLIPKRLTSLLAAILFFVFGLKLLREGLNMDPDEGVAAEMQEVEQELADKEKEQHGHPYRQHSLSPHALEMGLA
PRNPPRLPGQSSGRSIDDFVHGVGNLCSLLLSPAWVQTFAMTFLGEWGDRSQIATIAMAAGQDYAWVTLGAMCGH
AVCTGVAVVGGRAIAGRVSLKVVTVGGALAFLLFSIVYLIEALHG*
Coding >Ophcf2|06256
ATGCGCGCTCACACGCAGCCGACGCAGCCGACGCTCTCGCCGCCGCTGCTGCTGCTGCTGCTGCTACCGCTCCTG
GTCTCCTCGCTGGCTGGAAGTCTGAAACCCGAGCCGGCTACTGTCAGCCACGCCCGCGTCGAGCCTCGTCATTAC
GTACCGACAAAGGAGGCTCCCGTCGATGGCAGAGACGGGAAGCCACATACAGGCCCCTTTGTCGAAAAGACGGAT
TCGGACAGGACAGGCTTGCCCCCTCTCCGGGGCCGACCCGAGGATCCCACTGTCGTGGACGGCATCAAAATTCCA
AAGTCAAATGACGGCGTCATGTTTGATAGGAACCGCGAGCGTCCCCTAGAGGGCACCACCGGCACCGAGGGCGGC
GTCTCCGAAAAGGACAAGGCTCGCAAGGAAAAGGAGGGCCAGACCGGGGAGCGCACCGTCGGACAGCCCAAGTCA
CCCAAGGAGCAGCCCCGGCTACCAGACAGCGAGGAGAAGAAGCTGCAAACGAATGGCGACGACAGGTACAGGCCT
GCAGTGGAGGACAGCTCATCAAGCGGCTACACGGGGCTGGGGAAACCCGCAGACATACCCGACATCCCCCGCGAA
GACGCAATGCCTCCACCCAAGTCCAAGACCAGCGAAGCAGAAGTGCCCCTAACAGGTTCGCCACGCAAGACGAGC
CACAAAAGCAGCGACCTACACGCCGACGACGAAGACGGCATCATCCGACCCTTCCACTCCTTCGTCCTCTCCCTG
ACCATGATCCTGGTATCCGAGGTAGGCGACAAGACATTCCTGGTAGCAGCTCTCATGGCGATGAAGCACGATCGC
CTCCTCGTCTTCTCCGCCGCCTTTGGCGCCCTCCTCGTCATGACGGTCCTATCAGCGCTACTCGGGCACGCCGTC
CCGACGCTGATACCTAAGCGGCTCACCAGCCTCCTCGCCGCCATCCTCTTCTTCGTCTTCGGCCTCAAGCTCCTC
CGCGAAGGTCTGAACATGGATCCCGACGAGGGCGTCGCCGCCGAGATGCAAGAAGTAGAACAAGAGCTCGCCGAC
AAGGAAAAAGAACAACACGGCCATCCCTACCGTCAACATTCCCTCTCACCACACGCCCTAGAAATGGGCCTCGCC
CCCCGAAACCCCCCGCGGCTCCCAGGCCAAAGCAGCGGCCGCTCGATAGACGACTTCGTCCACGGCGTCGGAAAC
CTTTGCTCCCTCCTCCTCAGCCCAGCCTGGGTGCAGACCTTTGCCATGACCTTCCTGGGCGAGTGGGGTGACCGC
AGTCAGATCGCGACGATTGCAATGGCGGCTGGCCAGGATTACGCCTGGGTTACGCTGGGGGCTATGTGCGGTCAT
GCTGTTTGCACCGGCGTTGCCGTCGTGGGCGGGAGGGCTATAGCCGGACGCGTCAGCCTTAAAGTCGTTACCGTC
GGCGGTGCCCTCGCCTTCCTCCTCTTCTCCATCGTCTACCTCATCGAAGCTCTTCACGGCTAG
Transcript >Ophcf2|06256
ATGCGCGCTCACACGCAGCCGACGCAGCCGACGCTCTCGCCGCCGCTGCTGCTGCTGCTGCTGCTACCGCTCCTG
GTCTCCTCGCTGGCTGGAAGTCTGAAACCCGAGCCGGCTACTGTCAGCCACGCCCGCGTCGAGCCTCGTCATTAC
GTACCGACAAAGGAGGCTCCCGTCGATGGCAGAGACGGGAAGCCACATACAGGCCCCTTTGTCGAAAAGACGGAT
TCGGACAGGACAGGCTTGCCCCCTCTCCGGGGCCGACCCGAGGATCCCACTGTCGTGGACGGCATCAAAATTCCA
AAGTCAAATGACGGCGTCATGTTTGATAGGAACCGCGAGCGTCCCCTAGAGGGCACCACCGGCACCGAGGGCGGC
GTCTCCGAAAAGGACAAGGCTCGCAAGGAAAAGGAGGGCCAGACCGGGGAGCGCACCGTCGGACAGCCCAAGTCA
CCCAAGGAGCAGCCCCGGCTACCAGACAGCGAGGAGAAGAAGCTGCAAACGAATGGCGACGACAGGTACAGGCCT
GCAGTGGAGGACAGCTCATCAAGCGGCTACACGGGGCTGGGGAAACCCGCAGACATACCCGACATCCCCCGCGAA
GACGCAATGCCTCCACCCAAGTCCAAGACCAGCGAAGCAGAAGTGCCCCTAACAGGTTCGCCACGCAAGACGAGC
CACAAAAGCAGCGACCTACACGCCGACGACGAAGACGGCATCATCCGACCCTTCCACTCCTTCGTCCTCTCCCTG
ACCATGATCCTGGTATCCGAGGTAGGCGACAAGACATTCCTGGTAGCAGCTCTCATGGCGATGAAGCACGATCGC
CTCCTCGTCTTCTCCGCCGCCTTTGGCGCCCTCCTCGTCATGACGGTCCTATCAGCGCTACTCGGGCACGCCGTC
CCGACGCTGATACCTAAGCGGCTCACCAGCCTCCTCGCCGCCATCCTCTTCTTCGTCTTCGGCCTCAAGCTCCTC
CGCGAAGGTCTGAACATGGATCCCGACGAGGGCGTCGCCGCCGAGATGCAAGAAGTAGAACAAGAGCTCGCCGAC
AAGGAAAAAGAACAACACGGCCATCCCTACCGTCAACATTCCCTCTCACCACACGCCCTAGAAATGGGCCTCGCC
CCCCGAAACCCCCCGCGGCTCCCAGGCCAAAGCAGCGGCCGCTCGATAGACGACTTCGTCCACGGCGTCGGAAAC
CTTTGCTCCCTCCTCCTCAGCCCAGCCTGGGTGCAGACCTTTGCCATGACCTTCCTGGGCGAGTGGGGTGACCGC
AGTCAGATCGCGACGATTGCAATGGCGGCTGGCCAGGATTACGCCTGGGTTACGCTGGGGGCTATGTGCGGTCAT
GCTGTTTGCACCGGCGTTGCCGTCGTGGGCGGGAGGGCTATAGCCGGACGCGTCAGCCTTAAAGTCGTTACCGTC
GGCGGTGCCCTCGCCTTCCTCCTCTTCTCCATCGTCTACCTCATCGAAGCTCTTCACGGCTAG
Gene >Ophcf2|06256
ATGCGCGCTCACACGCAGCCGACGCAGCCGACGCTCTCGCCGCCGCTGCTGCTGCTGCTGCTGCTACCGCTCCTG
GTCTCCTCGCTGGCTGGAAGTCTGAAACCCGAGCCGGCTACTGTCAGCCACGCCCGCGTCGAGCCTCGTCATTAC
GTACCGACAAAGGAGGCTCCCGTCGATGGCAGAGACGGGAAGCCACATACAGGCCCCTTTGTCGAAAAGACGGAT
TCGGACAGGACAGGCTTGCCCCCTCTCCGGGGCCGACCCGAGGATCCCACTGTCGTGGACGGCATCAAAATTCCA
AAGTCAAATGACGGCGTCATGTTTGATAGGAACCGCGAGCGTCCCCTAGAGGGCACCACCGGCACCGAGGGCGGC
GTCTCCGAAAAGGACAAGGCTCGCAAGGAAAAGGAGGGCCAGACCGGGGAGCGCACCGTCGGACAGCCCAAGTCA
CCCAAGGAGCAGCCCCGGCTACCAGACAGCGAGGAGAAGAAGCTGCAAACGAATGGCGACGACAGGTACAGGCCT
GCAGTGGAGGACAGCTCATCAAGCGGCTACACGGGGCTGGGGGCAGGTTTTCCCCGTTCTCTTTACCCCAGATAT
TGATGCGATGAATTCGTCATGACCGTCTACTGACGCGCTACAACAGAAACCCGCAGACATACCCGACATCCCCCG
CGAAGACGCAATGCCTCCACCCAAGTCCAAGACCAGCGAAGCAGAAGTGCCCCTAACAGGTTCGCCACGCAAGAC
GAGCCACAAAAGCAGCGACCTACACGCCGACGACGAAGACGGCATCATCCGACCCTTCCACTCCTTCGTCCTCTC
CCTGACCATGATCCTGGTATCCGAGGTAGGCGACAAGACATTCCTGGTAGCAGCTCTCATGGCGATGAAGCACGA
TCGCCTCCTCGTCTTCTCCGCCGCCTTTGGCGCCCTCCTCGTCATGACGGTCCTATCAGCGCTACTCGGGCACGC
CGTCCCGACGCTGATACCTAAGCGGCTCACCAGCCTCCTCGCCGCCATCCTCTTCTTCGTCTTCGGCCTCAAGCT
CCTCCGCGAAGGTCTGAACATGGATCCCGACGAGGGCGTCGCCGCCGAGATGCAAGAAGTAGAACAAGAGCTCGC
CGACAAGGAAAAAGAACAACACGGCCATCCCTACCGTCAACATTCCCTCTCACCACACGCCCTAGAAATGGGCCT
CGCCCCCCGAAACCCCCCGCGGCTCCCGTTCAAAAGGCCGTTTCCCTCCCCCCCGATCCCCATCGCAATCCCCCT
CCCGCCCGTGCTCCCCAACCAGAGGCCAAAGCAGCGGCCGCTCGATAGACGACTTCGTCCACGGCGTCGGAAACC
TTTGCTCCCTCCTCCTCAGCCCAGCCTGGGTGCAGACCTTTGCCATGACCTTCCTGGGCGAGTGGGGTGACCGCA
GTCAGATCGCGACGATTGCAATGGCGGCTGGCCAGGATTACGCCTGGGTTACGCTGGGGGCTATGTGCGGTCATG
CTGTTTGCACCGGCGTTGCCGTCGTGGGCGGGAGGGCTATAGCCGGACGCGTCAGCCTTAAAGTCGGTGAGTCTC
TCACCTCGCTCCTCCTGTCTGCCTATCCGGTATACGCTGACAGGAATATTGGTGATAGTTACCGTCGGCGGTGCC
CTCGCCTTCCTCCTCTTCTCCATCGTCTACCTCATCGAAGCTCTTCACGGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail