Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06244
Gene name
Locationscaffold_07:1682003..1683488
Strand+
Gene length (bp)1485
Transcript length (bp)1293
Coding sequence length (bp)1293
Protein length (aa) 431

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00789 UBX UBX domain 8.4E-15 257 335

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Mitochondrial transit peptide 0.3647 0.2492 0.0314 0.1241 0.5343 0.0452 0.8393 0.3741 0.5302 0.1019

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1439
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3996
Ophiocordyceps australis map64 (Brazil) OphauB2|7460
Ophiocordyceps camponoti-floridani Ophcf2|06244 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7465
Ophiocordyceps kimflemingae Ophio5|3270
Ophiocordyceps subramaniannii Hirsu2|10964

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06244
MFFSGSLQEGISAAVEQQKMVLCFVTNDNEESRLWENDFLREASLGELIGNKAVALRLEAGSPSAGYLAEIFPLP
QTPTVVLMKHGELKDYIASGTVKDDFVRRVRAALDVSPPTAPSTAVPAGETESSTASDLGNVHSVLAERVAKLKA
KKEEADRRAKDERAEAKAKAAAEAEAGADTEAARSHRQAEMVRKQRQQKDEERRRILARIENDKQERRQRAAQRQ
QMRADALQTGDVASSLVKAPESKLPSTTRISDMASIQVRLFDGSTMRNRFKTCAPFTQVRAWVDEKRTDGSVPYT
FRQLLTPKPNTAIDETDEAKTLSDLGLAPSSTLILIPVQAFSTAYEAKPQSWIYRFVTTISGMLFWLASFLPLGF
GRRTTSSAPVVESTSGRTRRRISGFDDVVDPSKDQQLYNGNSLNFEPRPDEQDDS*
Coding >Ophcf2|06244
ATGTTCTTCTCGGGTTCGCTGCAGGAGGGCATCTCTGCCGCTGTCGAGCAGCAGAAGATGGTACTTTGCTTTGTG
ACGAACGACAACGAGGAGAGCAGACTATGGGAGAACGACTTTCTCCGGGAAGCCTCGCTGGGCGAGTTGATTGGG
AATAAAGCCGTCGCTCTTCGTCTCGAAGCAGGTTCCCCGTCGGCGGGCTACCTCGCCGAAATCTTTCCTCTACCC
CAGACACCCACCGTCGTCCTCATGAAGCATGGCGAGCTGAAGGATTATATCGCTTCCGGGACTGTCAAGGATGAC
TTTGTGCGTCGAGTGCGGGCCGCCTTGGACGTGTCGCCTCCGACTGCGCCGTCTACGGCTGTCCCAGCTGGAGAG
ACGGAATCTTCCACTGCTTCAGACTTGGGCAATGTACACAGCGTTCTCGCCGAGAGGGTAGCCAAGCTAAAGGCC
AAAAAGGAAGAGGCAGACCGCAGGGCAAAGGACGAACGTGCCGAGGCCAAGGCCAAGGCAGCAGCCGAAGCCGAA
GCCGGCGCCGATACCGAAGCCGCCAGATCCCATCGGCAGGCTGAAATGGTTCGCAAACAACGACAGCAAAAGGAT
GAGGAGCGCAGACGAATCCTCGCCCGTATCGAAAATGATAAACAGGAGCGACGCCAGCGAGCCGCACAGCGACAA
CAGATGCGCGCAGACGCCCTCCAAACAGGAGACGTCGCGTCCTCGCTCGTCAAGGCGCCGGAGTCCAAGCTCCCA
TCGACAACGCGCATCAGCGACATGGCCTCGATCCAAGTCCGGCTCTTTGACGGCTCAACGATGAGGAACCGCTTC
AAGACGTGCGCGCCTTTCACCCAGGTACGAGCCTGGGTGGACGAGAAGCGCACCGACGGCTCCGTACCCTATACA
TTCCGACAGCTTCTTACGCCGAAGCCCAACACGGCCATTGACGAGACGGATGAGGCCAAGACGCTCTCGGATCTA
GGTCTCGCCCCTTCGTCTACCCTCATTCTCATCCCCGTGCAGGCTTTTTCAACGGCATACGAGGCTAAGCCGCAG
AGCTGGATCTATCGCTTCGTGACTACCATCTCGGGCATGCTTTTCTGGCTGGCTTCTTTCCTCCCTCTTGGGTTT
GGGAGGCGGACGACGAGCTCGGCGCCTGTGGTGGAGTCTACGTCTGGTCGGACGCGTCGACGTATAAGCGGCTTT
GATGACGTTGTTGACCCTTCCAAGGATCAGCAGCTTTACAATGGGAACTCGTTGAACTTTGAGCCGAGGCCCGAT
GAACAGGACGATTCATAG
Transcript >Ophcf2|06244
ATGTTCTTCTCGGGTTCGCTGCAGGAGGGCATCTCTGCCGCTGTCGAGCAGCAGAAGATGGTACTTTGCTTTGTG
ACGAACGACAACGAGGAGAGCAGACTATGGGAGAACGACTTTCTCCGGGAAGCCTCGCTGGGCGAGTTGATTGGG
AATAAAGCCGTCGCTCTTCGTCTCGAAGCAGGTTCCCCGTCGGCGGGCTACCTCGCCGAAATCTTTCCTCTACCC
CAGACACCCACCGTCGTCCTCATGAAGCATGGCGAGCTGAAGGATTATATCGCTTCCGGGACTGTCAAGGATGAC
TTTGTGCGTCGAGTGCGGGCCGCCTTGGACGTGTCGCCTCCGACTGCGCCGTCTACGGCTGTCCCAGCTGGAGAG
ACGGAATCTTCCACTGCTTCAGACTTGGGCAATGTACACAGCGTTCTCGCCGAGAGGGTAGCCAAGCTAAAGGCC
AAAAAGGAAGAGGCAGACCGCAGGGCAAAGGACGAACGTGCCGAGGCCAAGGCCAAGGCAGCAGCCGAAGCCGAA
GCCGGCGCCGATACCGAAGCCGCCAGATCCCATCGGCAGGCTGAAATGGTTCGCAAACAACGACAGCAAAAGGAT
GAGGAGCGCAGACGAATCCTCGCCCGTATCGAAAATGATAAACAGGAGCGACGCCAGCGAGCCGCACAGCGACAA
CAGATGCGCGCAGACGCCCTCCAAACAGGAGACGTCGCGTCCTCGCTCGTCAAGGCGCCGGAGTCCAAGCTCCCA
TCGACAACGCGCATCAGCGACATGGCCTCGATCCAAGTCCGGCTCTTTGACGGCTCAACGATGAGGAACCGCTTC
AAGACGTGCGCGCCTTTCACCCAGGTACGAGCCTGGGTGGACGAGAAGCGCACCGACGGCTCCGTACCCTATACA
TTCCGACAGCTTCTTACGCCGAAGCCCAACACGGCCATTGACGAGACGGATGAGGCCAAGACGCTCTCGGATCTA
GGTCTCGCCCCTTCGTCTACCCTCATTCTCATCCCCGTGCAGGCTTTTTCAACGGCATACGAGGCTAAGCCGCAG
AGCTGGATCTATCGCTTCGTGACTACCATCTCGGGCATGCTTTTCTGGCTGGCTTCTTTCCTCCCTCTTGGGTTT
GGGAGGCGGACGACGAGCTCGGCGCCTGTGGTGGAGTCTACGTCTGGTCGGACGCGTCGACGTATAAGCGGCTTT
GATGACGTTGTTGACCCTTCCAAGGATCAGCAGCTTTACAATGGGAACTCGTTGAACTTTGAGCCGAGGCCCGAT
GAACAGGACGATTCATAG
Gene >Ophcf2|06244
ATGTTCTTCTCGGGTTCGCTGCAGGAGGGCATCTCTGCCGCTGTCGAGCAGCAGAAGATGGTACTTTGCTTTGTG
ACGAGTCAGTTGACTGTACCGCTTGCCCAAGGAACTGCGAGCTGATGGGCGTTTTTCTTCCTTGGCATTAGACGA
CAACGAGGAGAGCAGACTATGGGAGAACGACTTTCTCCGGGAAGCCTCGGTAGGCCGTTAGCTTCAAAGATGCAA
GCTGTCGAGATTCTGACCCGAGAAGCTGGGCGAGTTGATTGGGAATAAAGCCGTCGCTCTTCGTCTCGAAGCAGG
TTCCCCGTCGGCGGGCTACCTCGCCGAAATCTTTCCTCTACCCCAGACACCCACCGTCGTCCTCATGAAGCATGG
CGAGCTGAAGGATTATATCGCTTCCGGGACTGTCAAGGATGACTTTGTGCGTCGAGTGCGGGCCGCCTTGGACGT
GTCGCCTCCGACTGCGCCGTCTACGGCTGTCCCAGCTGGAGAGACGGAATCTTCCACTGCTTCAGACTTGGGCAA
TGTACACAGCGTTCTCGCCGAGAGGGTAGCCAAGCTAAAGGCCAAAAAGGAAGAGGCAGACCGCAGGGCAAAGGA
CGAACGTGCCGAGGCCAAGGCCAAGGCAGCAGCCGAAGCCGAAGCCGGCGCCGATACCGAAGCCGCCAGATCCCA
TCGGCAGGCTGAAATGGTTCGCAAACAACGACAGCAAAAGGATGAGGAGCGCAGACGAATCCTCGCCCGTATCGA
AAATGATAAACAGGAGCGACGCCAGCGAGCCGCACAGCGACAACAGATGCGCGCAGACGCCCTCCAAACAGGAGA
CGTCGCGTCCTCGCTCGTCAAGGCGCCGGAGTCCAAGCTCCCATCGACAACGCGCATCAGCGACATGGCCTCGAT
CCAAGTCCGGCTCTTTGACGGCTCAACGATGAGGAACCGCTTCAAGACGTGCGCGCCTTTCACCCAGGTACGAGC
CTGGGTGGACGAGAAGCGCACCGACGGCTCCGTACCCTATACATTCCGACAGCTTCTTACGCCGAAGCCCAACAC
GGCCATTGACGAGACGGATGAGGCCAAGACGCTCTCGGATCTAGGTCTCGCCCCTTCGTCTACCCTCATTCTCAT
CCCCGTGCAGGCTTTTTCAACGGCATACGAGGCTAAGCCGCAGAGCTGGATCTATCGCTTCGTGACTACCATCTC
GGGCATGCTTTTCTGGCTGGCTTCTTTCCTCCCTCTTGGGTTTGGGAGGCGGACGACGAGCTCGGCGCCTGTGGT
GGAGTCTACGTCTGGTCGGACGCGTCGACGTATAAGCGGCTTTGATGACGTTGTTGACCCTTCCAAGGATCAGCA
GCTTTACAATGGGAACTCGGTCAGTTGTTGCGTTGGGGGCTTCTTGGAGACAGAAAAAAAAGACAGAAAACACGA
GGCTGACATGAGACTCAGTTGAACTTTGAGCCGAGGCCCGATGAACAGGACGATTCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail