Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06243
Gene name
Locationscaffold_07:1680462..1681601
Strand-
Gene length (bp)1139
Transcript length (bp)873
Coding sequence length (bp)873
Protein length (aa) 291

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02104 SURF1 SURF1 family 4.3E-54 55 263

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 254 273 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 49.08 25.29 72.88
Alive In ants, during behavior modification 38.05 18.44 57.66
Dead In ants, recently dead 41.34 20.55 62.12

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.268548 no
Alive Dead 0.722437 no
Dead Fungus 0.472255 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06243
MTKMIRRICRPGISVSSSRQQPADDPTFVSILDGPPRIARIKRKHGPGLILLALIPITAFALGTWQVQRLRWKSE
LIAKLEDRLIRDPLPLPPHVDPSALDEFDYRRVVASGYFRHDQEMLIGPRIRDGQDGFLVVTPLERVDASTVLVN
RGWISKKFARQASRPDSLPTHLATVEGLLRKPWKKNMFTPDNKPESGQFYFPDVEQMAALTDSQPVWVESTTEPE
FMTIIDLESRGIPIGRSPEVSLRNNHAQYIVTWYSLCLATSVMFYMLVKKPPPGMARQLHPHRKF*
Coding >Ophcf2|06243
ATGACCAAGATGATCCGCCGCATCTGCCGCCCCGGAATCTCCGTATCGTCTTCAAGACAACAGCCAGCCGACGAC
CCAACCTTCGTCTCCATCCTCGACGGCCCCCCAAGAATCGCCCGAATCAAGCGCAAACACGGCCCCGGCCTCATC
CTCCTCGCCCTCATCCCAATCACCGCCTTCGCCCTCGGAACATGGCAGGTTCAACGCCTTCGCTGGAAATCAGAA
CTCATCGCTAAGCTAGAGGATCGGCTCATTCGAGATCCGCTTCCTCTGCCGCCGCATGTCGACCCGTCCGCCCTC
GATGAATTCGACTACCGCCGTGTCGTTGCATCGGGATATTTCCGTCATGATCAGGAGATGCTCATTGGGCCTCGG
ATTCGTGACGGCCAAGATGGCTTTCTCGTCGTCACGCCTCTTGAGAGGGTAGACGCGTCGACCGTCTTGGTAAAC
CGCGGCTGGATCAGCAAGAAGTTTGCCCGTCAGGCTTCCCGGCCCGATTCGCTTCCGACTCATCTCGCCACCGTC
GAGGGATTGCTGCGCAAGCCGTGGAAGAAGAACATGTTTACGCCCGATAACAAGCCCGAAAGCGGCCAATTTTAT
TTTCCCGACGTTGAGCAAATGGCTGCCCTGACCGACAGCCAGCCTGTTTGGGTCGAATCTACCACGGAGCCCGAG
TTCATGACCATAATAGACCTCGAGTCCCGCGGCATCCCCATCGGGCGGTCTCCCGAGGTCAGCTTGAGAAACAAC
CACGCGCAGTACATCGTCACCTGGTATTCCTTGTGCTTGGCCACATCCGTCATGTTCTACATGTTGGTCAAGAAA
CCTCCACCAGGCATGGCCCGTCAACTGCACCCGCACAGAAAATTCTAG
Transcript >Ophcf2|06243
ATGACCAAGATGATCCGCCGCATCTGCCGCCCCGGAATCTCCGTATCGTCTTCAAGACAACAGCCAGCCGACGAC
CCAACCTTCGTCTCCATCCTCGACGGCCCCCCAAGAATCGCCCGAATCAAGCGCAAACACGGCCCCGGCCTCATC
CTCCTCGCCCTCATCCCAATCACCGCCTTCGCCCTCGGAACATGGCAGGTTCAACGCCTTCGCTGGAAATCAGAA
CTCATCGCTAAGCTAGAGGATCGGCTCATTCGAGATCCGCTTCCTCTGCCGCCGCATGTCGACCCGTCCGCCCTC
GATGAATTCGACTACCGCCGTGTCGTTGCATCGGGATATTTCCGTCATGATCAGGAGATGCTCATTGGGCCTCGG
ATTCGTGACGGCCAAGATGGCTTTCTCGTCGTCACGCCTCTTGAGAGGGTAGACGCGTCGACCGTCTTGGTAAAC
CGCGGCTGGATCAGCAAGAAGTTTGCCCGTCAGGCTTCCCGGCCCGATTCGCTTCCGACTCATCTCGCCACCGTC
GAGGGATTGCTGCGCAAGCCGTGGAAGAAGAACATGTTTACGCCCGATAACAAGCCCGAAAGCGGCCAATTTTAT
TTTCCCGACGTTGAGCAAATGGCTGCCCTGACCGACAGCCAGCCTGTTTGGGTCGAATCTACCACGGAGCCCGAG
TTCATGACCATAATAGACCTCGAGTCCCGCGGCATCCCCATCGGGCGGTCTCCCGAGGTCAGCTTGAGAAACAAC
CACGCGCAGTACATCGTCACCTGGTATTCCTTGTGCTTGGCCACATCCGTCATGTTCTACATGTTGGTCAAGAAA
CCTCCACCAGGCATGGCCCGTCAACTGCACCCGCACAGAAAATTCTAG
Gene >Ophcf2|06243
ATGACCAAGATGATCCGCCGCATCTGCCGCCCCGGAATCTCCGTATCGTCTTCAGTCCGCCCCTCAGTATCTCTC
CAATCCCACCCAATTCCATCACCAGCCCGTTCGCCCTCCCACCTCTTCACAACCACCTCTCTCCGCCAGAGACAA
CAGCCAGCCGACGACCCAACCTTCGTCTCCATCCTCGACGGCCCCCCAAGAATCGCCCGAATCAAGCGCAAACAC
GGCCCCGGCCTCATCCTCCTCGGTACAGCCCAAAAAACGAAGAAAGCCAAGACGTTTCCTGATCCCCGCCTACAG
CCCTCATCCCAATCACCGCCTTCGCCCTCGGAACATGGCAGGTTCAACGCCTTCGCTGGAAATCAGAACTCATCG
CTAAGCTAGAGGATCGGCTCATTCGAGATCCGCTTCCTCTGCCGCCGCATGTCGACCCGTCCGCCCTCGATGAAT
TCGACTACCGCCGTGTCGTTGCATCGGGATATTTCCGTCATGATCAGGAGATGCTCATTGGGCCTCGGATTCGTG
ACGGCCAAGATGGCTTTCTCGTCGTCACGCCTCTTGAGAGGGTAGACGCGTCGACCGTCTTGGTAAACCGCGGCT
GGATCAGCAAGAAGTTTGCCCGTCAGGCTTCCCGGCCCGATTCGCTTCCGACTCATCTCGCCACCGTCGAGGGAT
TGCTGCGCAAGCCGTGGAAGAAGAACATGTTTACGCCCGATAACAAGCCCGAAAGCGGCCAATTTTATTTTCCCG
ACGTTGAGCAAATGGCTGCCCTGACCGACAGCCAGCCTGTTTGGGTCGAATCTACCACGGGTATATCCTCCTAGC
TGCCAGCCTCACCTCCTCCCTTGATCCTTCGTCCGGCGCTAAATGACGACAGAGCCCGAGTTCATGACCATAATA
GACCTCGAGTCCCGCGGCATCCCCATCGGGCGGTCTCCCGAGGTCAGCTTGAGAAACAACCACGCGCAGTACATC
GTCACCTGGTACGTCGCCCTTGCCCCCCCCCTTTGCTGGGAACCGATATTCTGACAAGACCCAGGTATTCCTTGT
GCTTGGCCACATCCGTCATGTTCTACATGTTGGTCAAGAAACCTCCACCAGGCATGGCCCGTCAACTGCACCCGC
ACAGAAAATTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail