Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06242
Gene name
Locationscaffold_07:1678864..1680455
Strand+
Gene length (bp)1591
Transcript length (bp)1485
Coding sequence length (bp)1485
Protein length (aa) 495

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF15511 CENP-T_C Centromere kinetochore component CENP-T histone fold 2.6E-42 364 471
PF15630 CENP-S CENP-S protein 4.3E-09 376 443
PF00125 Histone Core histone H2A/H2B/H3/H4 2.4E-07 375 440

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0071821 FANCM-MHF complex Yes
GO:0005575 cellular_component No
GO:1901363 heterocyclic compound binding No
GO:0032991 protein-containing complex No
GO:0003676 nucleic acid binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0140513 nuclear protein-containing complex No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3195 0.9237 0.052 0.055 0.0565 0.0026 0.0126 0.0096 0.0055 0.0009

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1441
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3994
Ophiocordyceps australis map64 (Brazil) OphauB2|7458
Ophiocordyceps camponoti-floridani Ophcf2|06242 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7463
Ophiocordyceps kimflemingae Ophio5|3272
Ophiocordyceps subramaniannii Hirsu2|10966

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06242
MTSATPARRALSADPPSAQTPRNVNSNAPTPHAAAARRALNQRRHALFTPGKVRRRSMEKREKTFDILRSLSRTL
APGSQPVPASSPLEDSSALVPDQTRLEDDDEEELPIDKPRLSLPLDDDDNDDSDLPMPRSSGLEDENYTAQSIEL
PRRALSEQPRLSMARVSDFFDQNSNYPIDETGRQSDFFTGLLEDLQARPSAGDLTLDRIDADQGRRTTLGRDSDF
GMQLPAGLDEQTTFLLSEPPTDHMGDASAIDRSLAEAADAILTPNADLTGGVDAVHHTLATADGLDLTQATFDGM
DLTQAAVDGPDLTQETFNGPDLTQATVDGPELAPEAGDDWDLMAPTKDQPSRPMRKRQKRISKHGAEYPPLPPSL
VKKVAQTVLHSSGLSNPRISADTLTALTQASDWFFEQLGDDLGAYAQHAKRKTIDESDVVTLMRRQRQIGPSVSL
FALAQKHLPRELLQDLRMPVPQPSKKRRRERNPDGEGEQDTEMA*
Coding >Ophcf2|06242
ATGACCTCCGCCACGCCCGCGCGAAGAGCCCTCAGCGCTGACCCGCCCTCAGCTCAGACGCCCCGAAACGTCAAC
AGCAACGCCCCCACCCCCCACGCCGCTGCCGCCCGTCGCGCCTTGAATCAGCGCCGCCACGCCCTCTTCACCCCC
GGCAAGGTCCGCCGTCGCAGCATGGAGAAACGCGAAAAGACGTTTGATATCCTGCGCTCGCTCAGCAGGACCTTG
GCCCCCGGTAGCCAGCCCGTACCCGCGTCGTCGCCCCTTGAAGATTCATCTGCCTTGGTGCCTGATCAGACGCGC
CTCGAGGACGATGACGAGGAGGAGCTGCCTATCGATAAGCCTCGTCTGTCCCTTCCGCTCGATGACGATGACAAT
GACGACTCCGACCTGCCGATGCCGCGCTCTTCCGGCCTCGAGGACGAAAATTACACGGCTCAGTCTATAGAGCTA
CCCCGACGCGCTCTGAGCGAGCAGCCCAGGCTATCCATGGCTAGGGTCAGCGACTTTTTCGACCAAAACAGCAAC
TATCCCATCGATGAGACAGGTCGTCAGTCCGATTTCTTCACCGGTCTACTTGAAGACCTTCAGGCTCGTCCGTCC
GCAGGCGACTTGACCCTGGATCGCATCGATGCAGACCAGGGCCGGCGCACGACTCTCGGCCGTGACAGCGACTTT
GGCATGCAACTCCCAGCCGGCCTTGACGAGCAGACCACCTTTTTGCTGTCTGAGCCGCCGACCGATCACATGGGA
GATGCATCCGCCATCGACCGCTCTCTCGCCGAGGCTGCCGATGCCATACTTACTCCTAACGCCGACCTGACGGGC
GGAGTCGATGCCGTCCATCACACACTAGCGACTGCCGACGGCCTCGATCTCACTCAGGCAACTTTTGATGGCATG
GACCTCACTCAGGCCGCTGTCGATGGCCCGGACCTTACACAGGAAACCTTTAATGGCCCCGATCTTACACAGGCG
ACAGTAGATGGCCCTGAACTCGCACCGGAAGCCGGCGACGACTGGGATCTGATGGCTCCAACCAAAGACCAGCCT
TCCCGGCCTATGCGCAAACGCCAGAAGCGCATCTCCAAGCACGGAGCCGAGTATCCGCCGCTACCGCCCTCGCTG
GTCAAGAAAGTGGCCCAAACAGTCCTTCACTCCTCCGGCCTCAGCAACCCCCGCATCTCGGCAGACACCTTGACG
GCCCTGACGCAGGCGTCCGACTGGTTCTTCGAGCAGCTCGGGGACGACTTGGGAGCCTACGCCCAGCATGCCAAA
CGCAAGACGATCGACGAGAGCGACGTCGTGACCCTGATGCGCCGGCAACGCCAAATCGGACCCAGCGTGTCCCTG
TTCGCGCTTGCACAGAAGCACCTACCAAGAGAGCTGCTTCAAGATTTGAGGATGCCCGTCCCTCAACCGTCCAAG
AAGCGCCGTCGCGAGCGGAACCCCGACGGCGAGGGCGAGCAAGACACCGAGATGGCCTGA
Transcript >Ophcf2|06242
ATGACCTCCGCCACGCCCGCGCGAAGAGCCCTCAGCGCTGACCCGCCCTCAGCTCAGACGCCCCGAAACGTCAAC
AGCAACGCCCCCACCCCCCACGCCGCTGCCGCCCGTCGCGCCTTGAATCAGCGCCGCCACGCCCTCTTCACCCCC
GGCAAGGTCCGCCGTCGCAGCATGGAGAAACGCGAAAAGACGTTTGATATCCTGCGCTCGCTCAGCAGGACCTTG
GCCCCCGGTAGCCAGCCCGTACCCGCGTCGTCGCCCCTTGAAGATTCATCTGCCTTGGTGCCTGATCAGACGCGC
CTCGAGGACGATGACGAGGAGGAGCTGCCTATCGATAAGCCTCGTCTGTCCCTTCCGCTCGATGACGATGACAAT
GACGACTCCGACCTGCCGATGCCGCGCTCTTCCGGCCTCGAGGACGAAAATTACACGGCTCAGTCTATAGAGCTA
CCCCGACGCGCTCTGAGCGAGCAGCCCAGGCTATCCATGGCTAGGGTCAGCGACTTTTTCGACCAAAACAGCAAC
TATCCCATCGATGAGACAGGTCGTCAGTCCGATTTCTTCACCGGTCTACTTGAAGACCTTCAGGCTCGTCCGTCC
GCAGGCGACTTGACCCTGGATCGCATCGATGCAGACCAGGGCCGGCGCACGACTCTCGGCCGTGACAGCGACTTT
GGCATGCAACTCCCAGCCGGCCTTGACGAGCAGACCACCTTTTTGCTGTCTGAGCCGCCGACCGATCACATGGGA
GATGCATCCGCCATCGACCGCTCTCTCGCCGAGGCTGCCGATGCCATACTTACTCCTAACGCCGACCTGACGGGC
GGAGTCGATGCCGTCCATCACACACTAGCGACTGCCGACGGCCTCGATCTCACTCAGGCAACTTTTGATGGCATG
GACCTCACTCAGGCCGCTGTCGATGGCCCGGACCTTACACAGGAAACCTTTAATGGCCCCGATCTTACACAGGCG
ACAGTAGATGGCCCTGAACTCGCACCGGAAGCCGGCGACGACTGGGATCTGATGGCTCCAACCAAAGACCAGCCT
TCCCGGCCTATGCGCAAACGCCAGAAGCGCATCTCCAAGCACGGAGCCGAGTATCCGCCGCTACCGCCCTCGCTG
GTCAAGAAAGTGGCCCAAACAGTCCTTCACTCCTCCGGCCTCAGCAACCCCCGCATCTCGGCAGACACCTTGACG
GCCCTGACGCAGGCGTCCGACTGGTTCTTCGAGCAGCTCGGGGACGACTTGGGAGCCTACGCCCAGCATGCCAAA
CGCAAGACGATCGACGAGAGCGACGTCGTGACCCTGATGCGCCGGCAACGCCAAATCGGACCCAGCGTGTCCCTG
TTCGCGCTTGCACAGAAGCACCTACCAAGAGAGCTGCTTCAAGATTTGAGGATGCCCGTCCCTCAACCGTCCAAG
AAGCGCCGTCGCGAGCGGAACCCCGACGGCGAGGGCGAGCAAGACACCGAGATGGCCTGA
Gene >Ophcf2|06242
ATGACCTCCGCCACGCCCGCGCGAAGAGCCCTCAGCGCTGACCCGCCCTCAGCTCAGACGCCCCGAAACGTCAAC
AGCAACGCCCCCACCCCCCACGCCGCTGCCGCCCGTCGCGCCTTGAATCAGCGCCGCCACGCCCTCTTCACCCCC
GGCAAGGTCCGCCGTCGCAGCATGGAGAAACGCGAAAAGACGTTTGATATCCTGCGCTCGCTCAGCAGGACCTTG
GCCCCCGGTAGCCAGCCCGTACCCGCGTCGTCGCCCCTTGAAGATTCATCTGCCTTGGTGCCTGATCAGACGCGC
CTCGAGGACGATGACGAGGAGGAGCTGCCTATCGATAAGCCTCGTCTGTCCCTTCCGCTCGATGACGATGACAAT
GACGACTCCGACCTGCCGATGCCGCGCTCTTCCGGCCTCGAGGACGAAAATTACACGGCTCAGTCTATAGAGCTA
CCCCGACGCGCTCTGAGCGAGCAGCCCAGGCTATCCATGGCTAGGGTCAGCGACTTTTTCGACCAAAACAGCAAC
TATCCCATCGATGAGACAGGTCGTCAGTCCGATTTCTTCACCGGTCTACTTGAAGACCTTCAGGCTCGTCCGTCC
GCAGGCGACTTGACCCTGGATCGGTAGGCACGACGCTCATTACCATCCTCCTTCTCGACTGACACCTACGCAGCA
TCGATGCAGACCAGGGCCGGCGCACGACTCTCGGCCGTGACAGCGACTTTGGCATGCAACTCCCAGCCGGCCTTG
ACGAGCAGACCACCTTTTTGCTGTCTGAGCCGCCGACCGATCACATGGGAGATGCATCCGCCATCGACCGCTCTC
TCGCCGAGGCTGCCGATGCCATACTTACTCCTAACGCCGACCTGACGGGCGGAGTCGATGCCGTCCATCACACAC
TAGCGACTGCCGACGGCCTCGATCTCACTCAGGCAACTTTTGATGGCATGGACCTCACTCAGGCCGCTGTCGATG
GCCCGGACCTTACACAGGAAACCTTTAATGGCCCCGATCTTACACAGGCGACAGTAGATGGCCCTGAACTCGCAC
CGGAAGCCGGCGACGACTGGGATCTGATGGCTCCAACCAAAGACCAGCCTTCCCGGCCTATGCGCAAACGCCAGA
AGCGCATCTCCAAGCACGGAGCCGAGTATCCGCCGCTACCGCCCTCGCTGGTCAAGAAAGTGGCCCAAACAGTCC
TTCACTCCTCCGGCCTCAGCAACCCCCGCATCTCGGCAGACACCTTGACGGCCCTGACGCAGGCGTCCGACTGGT
TCTTCGAGCAGCTCGGGGACGACTTGGGAGCCTACGCCCAGCATGCCAAACGCAAGACGATCGACGAGAGCGACG
TCGTGACCCTGATGCGCCGGTCGGTCTGCTCCAGGTCCTACCGGCTATCGTTGGGGAGGCTAAAATATGTCACAG
GCAACGCCAAATCGGACCCAGCGTGTCCCTGTTCGCGCTTGCACAGAAGCACCTACCAAGAGAGCTGCTTCAAGA
TTTGAGGATGCCCGTCCCTCAACCGTCCAAGAAGCGCCGTCGCGAGCGGAACCCCGACGGCGAGGGCGAGCAAGA
CACCGAGATGGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail