Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06235
Gene name
Locationscaffold_07:1666028..1666854
Strand+
Gene length (bp)826
Transcript length (bp)765
Coding sequence length (bp)765
Protein length (aa) 255

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00018 SH3_1 SH3 domain 3.8E-14 112 158
PF14604 SH3_9 Variant SH3 domain 1.6E-10 113 162
PF07653 SH3_2 Variant SH3 domain 7.0E-09 110 164

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5531 0.1731 0.0668 0.1638 0.2406 0.0044 0.3764 0.3728 0.2206 0.0707

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3707
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5054
Ophiocordyceps australis map64 (Brazil) OphauB2|7452
Ophiocordyceps camponoti-floridani Ophcf2|06235 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5423
Ophiocordyceps kimflemingae Ophio5|2109
Ophiocordyceps subramaniannii Hirsu2|7215

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06235
MVSAERQTIMETNRSLRNIKTELESLLEKGIIDESVFDSIHAALPQESPLSGPLRTTANRSEAPTQAMNNMTLSP
EPRSESQAPAPAPPSYNETPPPSLPSRNAKPIVGHARALYSYVASDARDVAFEKDDRIAIHERLNPDWWLGQNLR
TGQEGIFPRSYVLEEPDNKGTPQPGPAAAPYVQPQQPQYGYPPPQQNPYNANVPPMAVADDGHSGGGKESKGSQL
GKKFGKKLGNAAIFGAGATIGGNIVNSIF*
Coding >Ophcf2|06235
ATGGTGTCCGCTGAGCGTCAGACCATCATGGAGACCAATCGGTCACTCCGCAACATCAAGACGGAATTGGAAAGC
CTCCTCGAGAAGGGCATCATCGACGAGTCCGTCTTCGACTCCATTCACGCCGCGCTACCGCAGGAATCGCCACTC
TCAGGCCCCCTTCGAACGACGGCCAACAGGAGCGAAGCCCCTACGCAGGCCATGAACAACATGACCCTCAGCCCT
GAACCGCGCTCCGAATCTCAGGCTCCCGCCCCCGCGCCTCCCAGCTACAACGAGACGCCGCCTCCGAGCCTCCCA
TCCCGCAACGCCAAGCCCATCGTCGGCCACGCCCGCGCCCTGTATTCCTACGTCGCTTCTGACGCTCGCGACGTC
GCTTTCGAGAAGGACGACAGGATCGCCATACATGAGCGCCTCAACCCTGACTGGTGGCTCGGCCAGAACTTGCGC
ACCGGCCAGGAAGGCATCTTCCCCCGCAGTTACGTCCTCGAAGAGCCCGATAACAAGGGCACGCCTCAGCCGGGT
CCTGCTGCAGCCCCTTACGTGCAGCCGCAGCAGCCGCAGTACGGTTACCCGCCCCCGCAGCAGAACCCGTACAAC
GCAAATGTGCCGCCCATGGCCGTCGCCGATGACGGTCATTCGGGTGGGGGCAAGGAAAGCAAAGGGAGCCAGTTG
GGCAAGAAGTTTGGCAAGAAGCTGGGCAACGCTGCCATCTTTGGTGCTGGCGCCACCATCGGAGGCAACATTGTC
AACAGCATCTTTTAG
Transcript >Ophcf2|06235
ATGGTGTCCGCTGAGCGTCAGACCATCATGGAGACCAATCGGTCACTCCGCAACATCAAGACGGAATTGGAAAGC
CTCCTCGAGAAGGGCATCATCGACGAGTCCGTCTTCGACTCCATTCACGCCGCGCTACCGCAGGAATCGCCACTC
TCAGGCCCCCTTCGAACGACGGCCAACAGGAGCGAAGCCCCTACGCAGGCCATGAACAACATGACCCTCAGCCCT
GAACCGCGCTCCGAATCTCAGGCTCCCGCCCCCGCGCCTCCCAGCTACAACGAGACGCCGCCTCCGAGCCTCCCA
TCCCGCAACGCCAAGCCCATCGTCGGCCACGCCCGCGCCCTGTATTCCTACGTCGCTTCTGACGCTCGCGACGTC
GCTTTCGAGAAGGACGACAGGATCGCCATACATGAGCGCCTCAACCCTGACTGGTGGCTCGGCCAGAACTTGCGC
ACCGGCCAGGAAGGCATCTTCCCCCGCAGTTACGTCCTCGAAGAGCCCGATAACAAGGGCACGCCTCAGCCGGGT
CCTGCTGCAGCCCCTTACGTGCAGCCGCAGCAGCCGCAGTACGGTTACCCGCCCCCGCAGCAGAACCCGTACAAC
GCAAATGTGCCGCCCATGGCCGTCGCCGATGACGGTCATTCGGGTGGGGGCAAGGAAAGCAAAGGGAGCCAGTTG
GGCAAGAAGTTTGGCAAGAAGCTGGGCAACGCTGCCATCTTTGGTGCTGGCGCCACCATCGGAGGCAACATTGTC
AACAGCATCTTTTAG
Gene >Ophcf2|06235
ATGGTGTCCGCTGAGCGTCAGACCATCATGGAGACCAATCGGTCACTCCGCAACATCAAGACGGTAGGATTAAGA
TTCGTCACCCCCCTTCTTCGTCCGTCTCGCTCACGTTCTCGTCGTCAAGGAATTGGAAAGCCTCCTCGAGAAGGG
CATCATCGACGAGTCCGTCTTCGACTCCATTCACGCCGCGCTACCGCAGGAATCGCCACTCTCAGGCCCCCTTCG
AACGACGGCCAACAGGAGCGAAGCCCCTACGCAGGCCATGAACAACATGACCCTCAGCCCTGAACCGCGCTCCGA
ATCTCAGGCTCCCGCCCCCGCGCCTCCCAGCTACAACGAGACGCCGCCTCCGAGCCTCCCATCCCGCAACGCCAA
GCCCATCGTCGGCCACGCCCGCGCCCTGTATTCCTACGTCGCTTCTGACGCTCGCGACGTCGCTTTCGAGAAGGA
CGACAGGATCGCCATACATGAGCGCCTCAACCCTGACTGGTGGCTCGGCCAGAACTTGCGCACCGGCCAGGAAGG
CATCTTCCCCCGCAGTTACGTCCTCGAAGAGCCCGATAACAAGGGCACGCCTCAGCCGGGTCCTGCTGCAGCCCC
TTACGTGCAGCCGCAGCAGCCGCAGTACGGTTACCCGCCCCCGCAGCAGAACCCGTACAACGCAAATGTGCCGCC
CATGGCCGTCGCCGATGACGGTCATTCGGGTGGGGGCAAGGAAAGCAAAGGGAGCCAGTTGGGCAAGAAGTTTGG
CAAGAAGCTGGGCAACGCTGCCATCTTTGGTGCTGGCGCCACCATCGGAGGCAACATTGTCAACAGCATCTTTTA
G

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail