Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06233
Gene name
Locationscaffold_07:1663659..1664578
Strand+
Gene length (bp)919
Transcript length (bp)738
Coding sequence length (bp)738
Protein length (aa) 246

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 2.0E-10 9 63
PF01494 FAD_binding_3 FAD binding domain 8.1E-08 8 186
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 1.3E-04 11 37
PF00890 FAD_binding_2 FAD binding domain 1.9E-04 9 40

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0004497 monooxygenase activity Yes
GO:0000166 nucleotide binding No
GO:0043168 anion binding No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043167 ion binding No
GO:1901265 nucleoside phosphate binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.3482 0.3007 0.4236 0.0129 0.3324 0.186 0.0924 0.0877 0.1007 0.0972

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup339
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1109
Ophiocordyceps australis 1348a (Ghana) OphauG2|1662
Ophiocordyceps australis map64 (Brazil) OphauB2|588
Ophiocordyceps australis map64 (Brazil) OphauB2|6448
Ophiocordyceps camponoti-floridani Ophcf2|06233 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1945
Ophiocordyceps camponoti-rufipedis Ophun1|4166
Ophiocordyceps kimflemingae Ophio5|2110
Ophiocordyceps subramaniannii Hirsu2|4346
Ophiocordyceps subramaniannii Hirsu2|7114

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06233
MAVPQSSTVLVIGAGPAGAYAACCLAREGIDTVLLEAVKFPRYHIGESTLPSLRHFFKFIDVDRVFDSSVENGAL
TLALQNGAVFRLNQLHPDACTDFIEALGPDGYAWNLIRSESDDLLFRHARTCGAHAFDETKVDAIQFEANANRDE
AGGPGRPVSATWSRKDGSTGSITFDYLVDASGRNGILSTKYLRNRTFNRGLKNVASWGYWKSDALYGKGTSWEGL
PYFEALQGKLGHVSSVLSGS*
Coding >Ophcf2|06233
ATGGCAGTCCCCCAAAGCTCCACCGTCCTCGTCATAGGCGCCGGTCCAGCAGGAGCTTACGCGGCTTGCTGCCTG
GCACGGGAGGGCATCGACACCGTCCTGCTCGAGGCCGTCAAGTTCCCTCGATACCACATTGGCGAGAGCACGCTT
CCCTCGCTGCGACACTTCTTCAAGTTCATCGACGTTGACCGTGTCTTTGACTCCTCCGTTGAGAACGGCGCACTA
ACTCTAGCCCTGCAGAACGGAGCAGTCTTTAGACTCAATCAGCTCCATCCCGATGCCTGCACCGACTTCATCGAG
GCTCTGGGTCCTGACGGCTATGCTTGGAATCTGATTCGATCCGAATCGGACGACTTGCTCTTCAGGCACGCGAGG
ACTTGCGGGGCTCACGCCTTTGACGAGACAAAGGTCGACGCCATTCAATTCGAGGCCAACGCGAACCGGGACGAA
GCTGGAGGACCAGGAAGGCCCGTTTCCGCCACCTGGAGCCGTAAAGACGGGTCGACCGGGAGCATCACCTTTGAC
TATCTCGTCGATGCCAGTGGACGAAACGGAATCCTCAGCACCAAGTATTTGAGGAACAGGACCTTTAACCGCGGC
CTCAAGAATGTCGCCAGCTGGGGTTACTGGAAGAGCGACGCTCTGTACGGCAAGGGAACGTCCTGGGAGGGGCTC
CCGTACTTTGAGGCGCTGCAAGGCAAGTTGGGTCATGTCTCGTCCGTGCTTAGCGGTAGCTGA
Transcript >Ophcf2|06233
ATGGCAGTCCCCCAAAGCTCCACCGTCCTCGTCATAGGCGCCGGTCCAGCAGGAGCTTACGCGGCTTGCTGCCTG
GCACGGGAGGGCATCGACACCGTCCTGCTCGAGGCCGTCAAGTTCCCTCGATACCACATTGGCGAGAGCACGCTT
CCCTCGCTGCGACACTTCTTCAAGTTCATCGACGTTGACCGTGTCTTTGACTCCTCCGTTGAGAACGGCGCACTA
ACTCTAGCCCTGCAGAACGGAGCAGTCTTTAGACTCAATCAGCTCCATCCCGATGCCTGCACCGACTTCATCGAG
GCTCTGGGTCCTGACGGCTATGCTTGGAATCTGATTCGATCCGAATCGGACGACTTGCTCTTCAGGCACGCGAGG
ACTTGCGGGGCTCACGCCTTTGACGAGACAAAGGTCGACGCCATTCAATTCGAGGCCAACGCGAACCGGGACGAA
GCTGGAGGACCAGGAAGGCCCGTTTCCGCCACCTGGAGCCGTAAAGACGGGTCGACCGGGAGCATCACCTTTGAC
TATCTCGTCGATGCCAGTGGACGAAACGGAATCCTCAGCACCAAGTATTTGAGGAACAGGACCTTTAACCGCGGC
CTCAAGAATGTCGCCAGCTGGGGTTACTGGAAGAGCGACGCTCTGTACGGCAAGGGAACGTCCTGGGAGGGGCTC
CCGTACTTTGAGGCGCTGCAAGGCAAGTTGGGTCATGTCTCGTCCGTGCTTAGCGGTAGCTGA
Gene >Ophcf2|06233
ATGGCAGTCCCCCAAAGCTCCACCGTCCTCGTCATAGGCGCCGGTCCAGCAGGAGCTTACGCGGCTTGCTGCCTG
GCACGGGAGGGCATCGACACCGTCCTGCTCGAGGCCGTCAAGTTCCCTCGGTCAGTGAGCCGGTTCATACATACA
CATGTATTATCCGTAGCCCCCCTTCCCCTGACAACTGCCAGATACCACATTGGCGAGAGCACGCTTCCCTCGCTG
CGACACTTCTTCAAGTTCATCGACGTTGACCGTGTCTTTGACTCGTATGGCTTCTTTCAGAAGGAAAGTGACGAC
CGCACTGCGGAACAGCTCCGTTGAGAACGGCGCACTAACTCTAGCCCTGCAGAACGGAGCAGTCTTTAGACTCAA
TCAGCTCCATCCCGATGCCTGTCCGTCTGGCCTCCTCAAACCCGCTGCTATGAATGGGGCTATGAATGGGGCTGA
CGCGATAGGTTCAGGCACCGACTTCATCGAGGCTCTGGGTCCTGACGGCTATGCTTGGAATCTGATTCGATCCGA
ATCGGACGACTTGCTCTTCAGGCACGCGAGGACTTGCGGGGCTCACGCCTTTGACGAGACAAAGGTCGACGCCAT
TCAATTCGAGGCCAACGCGAACCGGGACGAAGCTGGAGGACCAGGAAGGCCCGTTTCCGCCACCTGGAGCCGTAA
AGACGGGTCGACCGGGAGCATCACCTTTGACTATCTCGTCGATGCCAGTGGACGAAACGGAATCCTCAGCACCAA
GTATTTGAGGAACAGGACCTTTAACCGCGGCCTCAAGAATGTCGCCAGCTGGGGTTACTGGAAGAGCGACGCTCT
GTACGGCAAGGGAACGTCCTGGGAGGGGCTCCCGTACTTTGAGGCGCTGCAAGGCAAGTTGGGTCATGTCTCGTC
CGTGCTTAGCGGTAGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail