Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06231
Gene name
Locationscaffold_07:1657444..1659046
Strand+
Gene length (bp)1602
Transcript length (bp)1488
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03972 MmgE_PrpD MmgE/PrpD N-terminal domain 6.9E-85 14 273
PF19305 MmgE_PrpD_C MmgE/PrpD C-terminal domain 1.8E-46 290 465

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus 0.4593 0.4725 0.0779 0.0637 0.2907 0.3948 0.0387 0.1564 0.1345 0.3083

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2911
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5052
Ophiocordyceps australis map64 (Brazil) OphauB2|7450
Ophiocordyceps camponoti-floridani Ophcf2|06231 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1947
Ophiocordyceps kimflemingae Ophio5|2112
Ophiocordyceps subramaniannii Hirsu2|4873

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06231
MSSSYLQRFDGEIQDIADYVANKTIDSDLAFSTARSILLDTLGCGLEGLRFSECSKLLGPIVPGTFVPNGTRVPG
TPFVLDPVNGAFNIGTMIRWLDFNDCWLAAEWGHPSDNLGAILAVADWVNRTNRAGGASKLAGGRIFTVRDVLEA
MIKAHEIQGCLALLNSFNRVGLDHVVLVKVASTAVVSNMLGLDQAQIADAVSQAWVDGQSLRTYRHAPNAMSRKS
WAAGDACQRAVGLALRVLKGEKGIPTVLTAPGWGFYDVLFKGKKLEFQRPYGSYVMENVLFKVSYPAEFHSQTAV
EASEKIHHLLKKIDKSASDIQSVTCRTHEACVRIIDKQFKPMENFADRDHCIQYMCAVMLVFGRLTAADYVDGGE
AATSELVESLRKKIKCVEDPQYTKDYHDPQLRSISNALTVTLNDGTVLDEVAVEVPLGHRQRRDEAKSAITAKYK
RHLTPHLAESRVEELVRLHEDGGKLDSMAVDEYVDLYVVKESKFL*
Coding >Ophcf2|06231
ATGTCTTCATCGTATCTGCAGCGCTTCGACGGCGAGATACAGGACATTGCTGATTATGTCGCTAACAAGACCATC
GACTCCGATTTGGCCTTTTCTACCGCCCGGTCCATCCTGCTCGATACGCTGGGCTGCGGTCTCGAGGGATTGCGT
TTCAGCGAGTGCTCCAAGCTCTTGGGACCCATCGTCCCCGGCACTTTCGTCCCCAATGGCACTCGAGTGCCCGGG
ACGCCCTTTGTGTTGGACCCGGTCAACGGTGCTTTCAACATCGGGACCATGATCCGCTGGCTCGACTTCAACGAC
TGCTGGCTGGCGGCTGAATGGGGCCATCCGTCGGACAACCTGGGCGCCATCCTCGCCGTCGCTGACTGGGTCAAC
CGCACCAACCGGGCCGGTGGTGCGTCAAAGCTGGCTGGCGGCCGCATCTTCACCGTTCGCGACGTGCTCGAAGCC
ATGATCAAGGCCCATGAGATTCAGGGCTGTCTGGCGCTGCTCAACTCGTTTAACCGCGTCGGCCTCGATCACGTC
GTTCTCGTCAAGGTCGCCAGTACCGCCGTCGTCTCCAACATGCTCGGCCTCGACCAAGCTCAAATCGCCGACGCC
GTCTCCCAGGCCTGGGTCGACGGTCAGAGCTTGCGAACCTACCGCCACGCCCCGAATGCCATGTCACGCAAGTCG
TGGGCCGCCGGCGACGCATGTCAGCGTGCCGTCGGCTTGGCTCTAAGGGTCCTCAAGGGCGAGAAGGGCATACCG
ACTGTCCTGACCGCTCCCGGCTGGGGTTTCTACGATGTTCTCTTCAAGGGTAAAAAGTTGGAGTTTCAACGTCCC
TACGGTAGCTATGTCATGGAGAATGTCTTGTTCAAGGTATCATATCCGGCCGAGTTCCACTCGCAGACGGCCGTC
GAGGCGTCGGAAAAGATTCATCATCTGCTCAAGAAGATTGACAAATCGGCGTCCGATATCCAATCCGTTACGTGC
CGCACACACGAGGCCTGCGTCCGCATCATCGACAAGCAATTCAAGCCCATGGAAAACTTTGCCGACCGCGACCAC
TGCATACAGTACATGTGCGCCGTCATGCTCGTCTTTGGCCGGTTGACAGCGGCAGATTACGTCGACGGCGGCGAG
GCGGCCACGTCGGAGCTGGTCGAGTCGCTACGCAAGAAGATCAAGTGCGTCGAGGATCCGCAGTATACCAAAGAC
TATCACGACCCTCAGTTGCGGAGCATCTCCAACGCGCTCACTGTCACGCTCAATGACGGAACGGTCCTGGACGAG
GTGGCGGTCGAGGTGCCGCTCGGTCATCGGCAGAGGCGTGATGAGGCCAAGAGCGCCATCACGGCCAAGTATAAG
CGTCACCTAACGCCTCATCTGGCGGAGAGCAGGGTCGAGGAGCTGGTCCGGCTACATGAAGATGGCGGCAAGCTG
GACTCGATGGCGGTGGACGAGTATGTCGATCTTTACGTCGTCAAGGAAAGCAAGTTTTTGTAG
Transcript >Ophcf2|06231
ATGTCTTCATCGTATCTGCAGCGCTTCGACGGCGAGATACAGGACATTGCTGATTATGTCGCTAACAAGACCATC
GACTCCGATTTGGCCTTTTCTACCGCCCGGTCCATCCTGCTCGATACGCTGGGCTGCGGTCTCGAGGGATTGCGT
TTCAGCGAGTGCTCCAAGCTCTTGGGACCCATCGTCCCCGGCACTTTCGTCCCCAATGGCACTCGAGTGCCCGGG
ACGCCCTTTGTGTTGGACCCGGTCAACGGTGCTTTCAACATCGGGACCATGATCCGCTGGCTCGACTTCAACGAC
TGCTGGCTGGCGGCTGAATGGGGCCATCCGTCGGACAACCTGGGCGCCATCCTCGCCGTCGCTGACTGGGTCAAC
CGCACCAACCGGGCCGGTGGTGCGTCAAAGCTGGCTGGCGGCCGCATCTTCACCGTTCGCGACGTGCTCGAAGCC
ATGATCAAGGCCCATGAGATTCAGGGCTGTCTGGCGCTGCTCAACTCGTTTAACCGCGTCGGCCTCGATCACGTC
GTTCTCGTCAAGGTCGCCAGTACCGCCGTCGTCTCCAACATGCTCGGCCTCGACCAAGCTCAAATCGCCGACGCC
GTCTCCCAGGCCTGGGTCGACGGTCAGAGCTTGCGAACCTACCGCCACGCCCCGAATGCCATGTCACGCAAGTCG
TGGGCCGCCGGCGACGCATGTCAGCGTGCCGTCGGCTTGGCTCTAAGGGTCCTCAAGGGCGAGAAGGGCATACCG
ACTGTCCTGACCGCTCCCGGCTGGGGTTTCTACGATGTTCTCTTCAAGGGTAAAAAGTTGGAGTTTCAACGTCCC
TACGGTAGCTATGTCATGGAGAATGTCTTGTTCAAGGTATCATATCCGGCCGAGTTCCACTCGCAGACGGCCGTC
GAGGCGTCGGAAAAGATTCATCATCTGCTCAAGAAGATTGACAAATCGGCGTCCGATATCCAATCCGTTACGTGC
CGCACACACGAGGCCTGCGTCCGCATCATCGACAAGCAATTCAAGCCCATGGAAAACTTTGCCGACCGCGACCAC
TGCATACAGTACATGTGCGCCGTCATGCTCGTCTTTGGCCGGTTGACAGCGGCAGATTACGTCGACGGCGGCGAG
GCGGCCACGTCGGAGCTGGTCGAGTCGCTACGCAAGAAGATCAAGTGCGTCGAGGATCCGCAGTATACCAAAGAC
TATCACGACCCTCAGTTGCGGAGCATCTCCAACGCGCTCACTGTCACGCTCAATGACGGAACGGTCCTGGACGAG
GTGGCGGTCGAGGTGCCGCTCGGTCATCGGCAGAGGCGTGATGAGGCCAAGAGCGCCATCACGGCCAAGTATAAG
CGTCACCTAACGCCTCATCTGGCGGAGAGCAGGGTCGAGGAGCTGGTCCGGCTACATGAAGATGGCGGCAAGCTG
GACTCGATGGCGGTGGACGAGTATGTCGATCTTTACGTCGTCAAGGAAAGCAAGTTTTTGTAG
Gene >Ophcf2|06231
ATGTCTTCATCGTATCTGCAGCGCTTCGACGGCGAGATACAGGACATTGCTGATTATGTCGCTAACAAGACCATC
GACTCCGATTTGGCCGTCAGTCCCTCGACACACAACCTACCCTCAGGCTCCCGAGCTGACGGAGACGATGCAGTT
TTCTACCGCCCGGTCCATCCTGCTCGATACGCTGGGCTGCGGTCTCGAGGGATTGCGTTTCAGCGAGTGCTCCAA
GCTCTTGGGACCCATCGTCCCCGGCACTTTCGTCCCCAATGGCACTCGAGTGCCCGGGACGCCCTTTGTGTTGGA
CCCGGTCAACGGTGCTTTCAACATCGGGACCATGATCCGCTGGCTCGACTTCAACGACTGCTGGCTGGCGGCTGA
ATGGGGCCATCCGTCGGACAACCTGGGCGCCATCCTCGCCGTCGCTGACTGGGTCAACCGCACCAACCGGGCCGG
TGGTGCGTCAAAGCTGGCTGGCGGCCGCATCTTCACCGTTCGCGACGTGCTCGAAGCCATGATCAAGGCCCATGA
GATTCAGGGCTGTCTGGCGCTGCTCAACTCGTTTAACCGCGTCGGCCTCGATCACGTCGTTCTCGTCAAGGTCGC
CAGTACCGCCGTCGTCTCCAACATGCTCGGCCTCGACCAAGCTCAAATCGCCGACGCCGTCTCCCAGGCCTGGGT
CGACGGTCAGAGCTTGCGAACCTACCGCCACGCCCCGAATGCCATGTCACGCAAGTCGTGGGCCGCCGGCGACGC
ATGTCAGCGTGCCGTCGGCTTGGCTCTAAGGGTCCTCAAGGGCGAGAAGGGCATACCGACTGTCCTGACCGCTCC
CGGCTGGGGTTTCTACGATGTTCTCTTCAAGGGTAAAAAGTTGGAGTTTCAACGTCCCTACGGTAGCTATGTCAT
GGAGAATGTCTTGTTCAAGGTATCATATCCGGGTAAGTGGTTTGATGGCAACGACATGTAAGCAAGCATCTAGTC
TGACACGCCACAGCCGAGTTCCACTCGCAGACGGCCGTCGAGGCGTCGGAAAAGATTCATCATCTGCTCAAGAAG
ATTGACAAATCGGCGTCCGATATCCAATCCGTTACGTGCCGCACACACGAGGCCTGCGTCCGCATCATCGACAAG
CAATTCAAGCCCATGGAAAACTTTGCCGACCGCGACCACTGCATACAGTACATGTGCGCCGTCATGCTCGTCTTT
GGCCGGTTGACAGCGGCAGATTACGTCGACGGCGGCGAGGCGGCCACGTCGGAGCTGGTCGAGTCGCTACGCAAG
AAGATCAAGTGCGTCGAGGATCCGCAGTATACCAAAGACTATCACGACCCTCAGTTGCGGAGCATCTCCAACGCG
CTCACTGTCACGCTCAATGACGGAACGGTCCTGGACGAGGTGGCGGTCGAGGTGCCGCTCGGTCATCGGCAGAGG
CGTGATGAGGCCAAGAGCGCCATCACGGCCAAGTATAAGCGTCACCTAACGCCTCATCTGGCGGAGAGCAGGGTC
GAGGAGCTGGTCCGGCTACATGAAGATGGCGGCAAGCTGGACTCGATGGCGGTGGACGAGTATGTCGATCTTTAC
GTCGTCAAGGAAAGCAAGTTTTTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail