Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06230
Gene name
Locationscaffold_07:1652959..1655221
Strand-
Gene length (bp)2262
Transcript length (bp)2136
Coding sequence length (bp)2136
Protein length (aa) 712

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03441 FAD_binding_7 FAD binding domain of DNA photolyase 9.8E-48 328 516
PF00875 DNA_photolyase DNA photolyase 3.9E-21 9 193

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5002 0.7577 0.0556 0.0441 0.1553 0.0862 0.0714 0.0368 0.0624 0.0075

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup3159
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7780
Ophiocordyceps australis map64 (Brazil) OphauB2|7449
Ophiocordyceps camponoti-floridani Ophcf2|06230 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|1948
Ophiocordyceps kimflemingae Ophio5|2114
Ophiocordyceps subramaniannii Hirsu2|5603

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06230
MGAGNNLLVYLLRRDLRVSDNPVLHHLATSSDHGFTHLLPVYVFPARQVEVSGFLRQGQQSPYPPARSLVGGYWR
CGPHRAKFIAQAVWDLKDSLEQVGSGLTIRVGDVKDVLSHLIHDLEGKSSRLGAVWMTEELSWEERQEQDEVASL
CSDNGIDFKLWQDEKYFVDDRDTGLSKPRDLPDVFTTYRKSQEPLLSDQESPFDIPDSLDELEANLLQPLDDIIS
DPPRLSDEAQSSHPFRGGERRARERLSQLLRSGAVTTYKETRNGLLGAEFSTKLSAYLALGCISARQVHEALLKF
EDGEDSSYQEADGYGKGENDGTKGIRFELLWRDYMRLCTAKFGRKLFSLSGFTQDKSYGAKWKTADKKMAPTGQS
PSPEAVAKQLDRFHRGNTGMGLIDASQRELFLTGYTSNRARQNAASFLAKHLDIDWRYGAEWYEMMLVDYDVSSN
WANWQYVAGVGNDPRGDARIFNPVKQAFDYDKEGNYVRTWVPELKKLEKSENVFQVWTTSPEDLASADLTDNIMA
TNPLKRIDFRLDRKPRSSRRPFQRKRGGQGRGGGRRGGGGGGGGGGGGGGGGGGGGGGPNVGGGQHYGPSRSEKA
MASNHANSQATPDSWEQRNGNGGKNYSSSHNQAAMVRDKQAYHGHMFAPNGFDNSGRWYSDQSVRGRGNHHGYFS
GSGRWYGYRPGFRDMRYHQPPFAPMAAYPTMHPGPH*
Coding >Ophcf2|06230
ATGGGTGCCGGCAACAATCTCCTCGTCTACCTGCTCCGCCGGGACCTCCGTGTCTCGGACAATCCCGTCCTCCAT
CATTTGGCCACCTCTTCCGATCACGGCTTCACCCATTTACTGCCCGTCTACGTCTTTCCCGCACGTCAGGTCGAA
GTCTCCGGCTTCCTTCGTCAGGGCCAGCAGTCCCCGTACCCGCCTGCACGAAGTCTGGTGGGCGGGTATTGGAGA
TGCGGGCCTCATCGGGCCAAATTCATCGCACAGGCAGTCTGGGACCTCAAGGATAGTCTGGAGCAGGTGGGAAGT
GGCCTGACCATCCGCGTTGGCGACGTCAAGGATGTCCTCTCTCATCTGATACACGACTTGGAAGGCAAGTCGTCT
CGGTTGGGCGCCGTCTGGATGACGGAAGAGCTATCCTGGGAAGAGCGTCAGGAGCAGGATGAAGTTGCCTCATTG
TGTTCAGACAATGGGATAGACTTTAAGCTGTGGCAGGATGAGAAATACTTTGTCGACGACCGCGATACGGGTCTC
TCGAAGCCGCGTGATCTACCCGACGTCTTCACAACCTATCGCAAGTCGCAAGAGCCTCTTCTTTCAGATCAAGAA
AGCCCCTTCGATATTCCGGACTCGCTCGATGAACTCGAGGCAAACTTGTTGCAGCCTCTCGACGACATAATCTCT
GATCCGCCACGGTTGTCCGACGAGGCGCAATCCAGTCATCCGTTTCGAGGCGGCGAGCGGCGTGCCCGGGAGCGA
CTGAGCCAGCTTCTCAGGTCTGGCGCCGTTACGACGTACAAAGAGACACGCAATGGTCTACTAGGGGCCGAGTTC
AGCACGAAACTGTCTGCCTACCTGGCCTTGGGATGCATCTCCGCTAGACAGGTTCACGAGGCTTTGCTGAAGTTT
GAGGATGGGGAAGACTCTTCATACCAGGAGGCCGACGGCTATGGCAAAGGCGAAAATGACGGCACCAAGGGAATT
CGATTTGAACTGCTCTGGCGCGATTACATGCGGTTGTGTACAGCAAAGTTTGGTCGCAAGCTGTTCAGCCTATCC
GGCTTCACGCAGGACAAGAGCTATGGTGCCAAGTGGAAGACAGCTGACAAGAAGATGGCCCCGACCGGTCAATCA
CCATCGCCTGAGGCGGTTGCCAAACAGCTGGATCGCTTTCATCGAGGCAACACCGGCATGGGACTCATCGATGCC
TCGCAGCGGGAGCTGTTTCTAACCGGATACACGTCCAACAGAGCCAGACAGAACGCCGCCAGCTTCCTGGCCAAA
CACCTCGACATTGATTGGCGTTACGGGGCGGAGTGGTATGAGATGATGCTCGTCGACTATGACGTCTCGTCCAAC
TGGGCCAACTGGCAATATGTCGCAGGCGTGGGCAACGACCCAAGAGGCGACGCTCGCATCTTCAACCCCGTCAAG
CAAGCCTTCGACTACGACAAGGAGGGAAATTACGTGCGCACGTGGGTTCCGGAGTTGAAGAAACTGGAAAAGTCA
GAAAACGTCTTCCAAGTGTGGACTACCAGCCCTGAAGATTTGGCCAGCGCCGACCTCACAGATAACATCATGGCA
ACGAACCCCCTGAAGCGGATTGACTTCAGGCTGGACCGGAAGCCTCGCAGTTCTCGAAGACCTTTCCAGCGGAAA
CGTGGGGGCCAGGGTCGAGGTGGTGGCCGTCGAGGCGGAGGAGGTGGAGGAGGAGGTGGAGGCGGAGGAGGCGGA
GGTGGAGGAGGAGGAGGTGGAGGCCCAAATGTCGGGGGTGGTCAACATTATGGACCAAGTCGTTCCGAGAAGGCC
ATGGCCTCCAACCACGCCAATTCCCAGGCGACGCCTGATTCATGGGAGCAACGGAACGGCAACGGTGGCAAGAAC
TATTCCTCGTCACACAACCAAGCTGCCATGGTCCGTGACAAGCAGGCCTATCATGGGCACATGTTTGCCCCGAAC
GGTTTCGACAACAGCGGTCGTTGGTATTCCGATCAGAGTGTACGCGGGCGCGGCAATCATCACGGTTACTTCAGT
GGAAGTGGACGCTGGTACGGCTACAGACCGGGGTTCAGAGACATGAGATATCATCAGCCGCCGTTTGCACCCATG
GCGGCGTATCCGACAATGCACCCGGGGCCGCACTAG
Transcript >Ophcf2|06230
ATGGGTGCCGGCAACAATCTCCTCGTCTACCTGCTCCGCCGGGACCTCCGTGTCTCGGACAATCCCGTCCTCCAT
CATTTGGCCACCTCTTCCGATCACGGCTTCACCCATTTACTGCCCGTCTACGTCTTTCCCGCACGTCAGGTCGAA
GTCTCCGGCTTCCTTCGTCAGGGCCAGCAGTCCCCGTACCCGCCTGCACGAAGTCTGGTGGGCGGGTATTGGAGA
TGCGGGCCTCATCGGGCCAAATTCATCGCACAGGCAGTCTGGGACCTCAAGGATAGTCTGGAGCAGGTGGGAAGT
GGCCTGACCATCCGCGTTGGCGACGTCAAGGATGTCCTCTCTCATCTGATACACGACTTGGAAGGCAAGTCGTCT
CGGTTGGGCGCCGTCTGGATGACGGAAGAGCTATCCTGGGAAGAGCGTCAGGAGCAGGATGAAGTTGCCTCATTG
TGTTCAGACAATGGGATAGACTTTAAGCTGTGGCAGGATGAGAAATACTTTGTCGACGACCGCGATACGGGTCTC
TCGAAGCCGCGTGATCTACCCGACGTCTTCACAACCTATCGCAAGTCGCAAGAGCCTCTTCTTTCAGATCAAGAA
AGCCCCTTCGATATTCCGGACTCGCTCGATGAACTCGAGGCAAACTTGTTGCAGCCTCTCGACGACATAATCTCT
GATCCGCCACGGTTGTCCGACGAGGCGCAATCCAGTCATCCGTTTCGAGGCGGCGAGCGGCGTGCCCGGGAGCGA
CTGAGCCAGCTTCTCAGGTCTGGCGCCGTTACGACGTACAAAGAGACACGCAATGGTCTACTAGGGGCCGAGTTC
AGCACGAAACTGTCTGCCTACCTGGCCTTGGGATGCATCTCCGCTAGACAGGTTCACGAGGCTTTGCTGAAGTTT
GAGGATGGGGAAGACTCTTCATACCAGGAGGCCGACGGCTATGGCAAAGGCGAAAATGACGGCACCAAGGGAATT
CGATTTGAACTGCTCTGGCGCGATTACATGCGGTTGTGTACAGCAAAGTTTGGTCGCAAGCTGTTCAGCCTATCC
GGCTTCACGCAGGACAAGAGCTATGGTGCCAAGTGGAAGACAGCTGACAAGAAGATGGCCCCGACCGGTCAATCA
CCATCGCCTGAGGCGGTTGCCAAACAGCTGGATCGCTTTCATCGAGGCAACACCGGCATGGGACTCATCGATGCC
TCGCAGCGGGAGCTGTTTCTAACCGGATACACGTCCAACAGAGCCAGACAGAACGCCGCCAGCTTCCTGGCCAAA
CACCTCGACATTGATTGGCGTTACGGGGCGGAGTGGTATGAGATGATGCTCGTCGACTATGACGTCTCGTCCAAC
TGGGCCAACTGGCAATATGTCGCAGGCGTGGGCAACGACCCAAGAGGCGACGCTCGCATCTTCAACCCCGTCAAG
CAAGCCTTCGACTACGACAAGGAGGGAAATTACGTGCGCACGTGGGTTCCGGAGTTGAAGAAACTGGAAAAGTCA
GAAAACGTCTTCCAAGTGTGGACTACCAGCCCTGAAGATTTGGCCAGCGCCGACCTCACAGATAACATCATGGCA
ACGAACCCCCTGAAGCGGATTGACTTCAGGCTGGACCGGAAGCCTCGCAGTTCTCGAAGACCTTTCCAGCGGAAA
CGTGGGGGCCAGGGTCGAGGTGGTGGCCGTCGAGGCGGAGGAGGTGGAGGAGGAGGTGGAGGCGGAGGAGGCGGA
GGTGGAGGAGGAGGAGGTGGAGGCCCAAATGTCGGGGGTGGTCAACATTATGGACCAAGTCGTTCCGAGAAGGCC
ATGGCCTCCAACCACGCCAATTCCCAGGCGACGCCTGATTCATGGGAGCAACGGAACGGCAACGGTGGCAAGAAC
TATTCCTCGTCACACAACCAAGCTGCCATGGTCCGTGACAAGCAGGCCTATCATGGGCACATGTTTGCCCCGAAC
GGTTTCGACAACAGCGGTCGTTGGTATTCCGATCAGAGTGTACGCGGGCGCGGCAATCATCACGGTTACTTCAGT
GGAAGTGGACGCTGGTACGGCTACAGACCGGGGTTCAGAGACATGAGATATCATCAGCCGCCGTTTGCACCCATG
GCGGCGTATCCGACAATGCACCCGGGGCCGCACTAG
Gene >Ophcf2|06230
ATGGGTGCCGGCAACAATCTCCTCGTCTACCTGCTCCGCCGGGACCTCCGTGTCTCGGACAATCCCGTCCTCCAT
CATTTGGCCACCTCTTCCGATCACGGCTTCACCCATTTACTGCCCGTCTACGTCTTTCCCGCACGTCAGGTCGAA
GTCTCCGGCTTCCTTCGTCAGGGCCAGCAGTCCCCGTACCCGCCTGCACGAAGTCTGGTGGGCGGGTATTGGAGA
TGCGGGCCTCATCGGGCCAAATTCATCGCACAGGCAGTCTGGGACCTCAAGGATAGTCTGGAGCAGGTGGGAAGT
GGCCTGACCATCCGCGTTGGCGACGTCAAGGATGTCCTCTCTCATCTGATACACGACTTGGAAGGCAAGTCGTCT
CGGTTGGGCGCCGTCTGGATGACGGAAGAGCTATCCTGGGAAGAGCGTCAGGAGCAGGATGAAGTTGCCTCATTG
TGTTCAGACAATGGGATAGACTTTAAGCTGTGGCAGGATGAGAAATACTTTGTCGACGAGTGAGACCCCTGAACC
AAACTGTCTGGCAGTTTCTGACTTTGTCGTCGTCTCAGCCGCGATACGGGTCTCTCGAAGCCGCGTGATCTACCC
GACGTCTTCACAACCTATCGCAAGTCGCAAGAGCCTCTTCGTGAGAGACCTCGAAGTGTATTGCCGACTCCATCA
AAGTCAGACTTGCCCCCAGTGCCTGAAGAGTCTATAGTTTCAGATCAAGAAAGCCCCTTCGATATTCCGGACTCG
CTCGATGAACTCGAGGCAAACTTGTTGCAGCCTCTCGACGACATAATCTCTGATCCGCCACGGTTGTCCGACGAG
GCGCAATCCAGTCATCCGTTTCGAGGCGGCGAGCGGCGTGCCCGGGAGCGACTGAGCCAGCTTCTCAGGTCTGGC
GCCGTTACGACGTACAAAGAGACACGCAATGGTCTACTAGGGGCCGAGTTCAGCACGAAACTGTCTGCCTACCTG
GCCTTGGGATGCATCTCCGCTAGACAGGTTCACGAGGCTTTGCTGAAGTTTGAGGATGGGGAAGACTCTTCATAC
CAGGAGGCCGACGGCTATGGCAAAGGCGAAAATGACGGCACCAAGGGAATTCGATTTGAACTGCTCTGGCGCGAT
TACATGCGGTTGTGTACAGCAAAGTTTGGTCGCAAGCTGTTCAGCCTATCCGGCTTCACGCAGGACAAGAGCTAT
GGTGCCAAGTGGAAGACAGCTGACAAGAAGATGGCCCCGACCGGTCAATCACCATCGCCTGAGGCGGTTGCCAAA
CAGCTGGATCGCTTTCATCGAGGCAACACCGGCATGGGACTCATCGATGCCTCGCAGCGGGAGCTGTTTCTAACC
GGATACACGTCCAACAGAGCCAGACAGAACGCCGCCAGCTTCCTGGCCAAACACCTCGACATTGATTGGCGTTAC
GGGGCGGAGTGGTATGAGATGATGCTCGTCGACTATGACGTCTCGTCCAACTGGGCCAACTGGCAATATGTCGCA
GGCGTGGGCAACGACCCAAGAGGCGACGCTCGCATCTTCAACCCCGTCAAGCAAGCCTTCGACTACGACAAGGAG
GGAAATTACGTGCGCACGTGGGTTCCGGAGTTGAAGAAACTGGAAAAGTCAGAAAACGTCTTCCAAGTGTGGACT
ACCAGCCCTGAAGATTTGGCCAGCGCCGACCTCACAGATAACATCATGGCAACGAACCCCCTGAAGCGGATTGAC
TTCAGGCTGGACCGGAAGCCTCGCAGTTCTCGAAGACCTTTCCAGCGGAAACGTGGGGGCCAGGGTCGAGGTGGT
GGCCGTCGAGGCGGAGGAGGTGGAGGAGGAGGTGGAGGCGGAGGAGGCGGAGGTGGAGGAGGAGGAGGTGGAGGC
CCAAATGTCGGGGGTGGTCAACATTATGGACCAAGTCGTTCCGAGAAGGCCATGGCCTCCAACCACGCCAATTCC
CAGGCGACGCCTGATTCATGGGAGCAACGGAACGGCAACGGTGGCAAGAACTATTCCTCGTCACACAACCAAGCT
GCCATGGTCCGTGACAAGCAGGCCTATCATGGGCACATGTTTGCCCCGAACGGTTTCGACAACAGCGGTCGTTGG
TATTCCGATCAGAGTGTACGCGGGCGCGGCAATCATCACGGTTACTTCAGTGGAAGTGGACGCTGGTACGGCTAC
AGACCGGGGTTCAGAGACATGAGATATCATCAGCCGCCGTTTGCACCCATGGCGGCGTATCCGACAATGCACCCG
GGGCCGCACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail