Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06227
Gene name
Locationscaffold_07:1649240..1649668
Strand-
Gene length (bp)428
Transcript length (bp)288
Coding sequence length (bp)288
Protein length (aa) 96

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.088 0.0764 0.9695 0.0425 0.1133 0.0107 0.0473 0.087 0.0885 0.005

SignalP

SignalP signal predicted Location Score
Yes 1 - 25 0.999713

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup6519
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|583
Ophiocordyceps camponoti-floridani Ophcf2|06227 (this protein)
Ophiocordyceps kimflemingae Ophio5|2117
Ophiocordyceps subramaniannii Hirsu2|1175

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06227
MKFTAVFALAMATVAVAQSSTLNRRDNVLLPRKACSGTRSDEDKCRGQRLSPQNSFNNCKIRGGKCCARNKDGSE
LRRKKVSYDLTMSFARGIQF*
Coding >Ophcf2|06227
ATGAAGTTCACAGCCGTCTTTGCTCTTGCGATGGCCACCGTCGCCGTCGCGCAGTCTTCGACGCTCAACCGTCGC
GATAACGTGCTTCTTCCCCGCAAGGCGTGCAGCGGAACGAGGAGCGACGAGGATAAATGCAGGGGACAACGACTG
TCGCCCCAGAACTCGTTCAACAACTGCAAGATCCGGGGTGGCAAGTGCTGCGCCAGGAATAAGGATGGGAGCGAG
CTTAGAAGGAAGAAGGTTTCTTACGATTTGACGATGAGCTTCGCCCGTGGGATACAGTTCTAG
Transcript >Ophcf2|06227
ATGAAGTTCACAGCCGTCTTTGCTCTTGCGATGGCCACCGTCGCCGTCGCGCAGTCTTCGACGCTCAACCGTCGC
GATAACGTGCTTCTTCCCCGCAAGGCGTGCAGCGGAACGAGGAGCGACGAGGATAAATGCAGGGGACAACGACTG
TCGCCCCAGAACTCGTTCAACAACTGCAAGATCCGGGGTGGCAAGTGCTGCGCCAGGAATAAGGATGGGAGCGAG
CTTAGAAGGAAGAAGGTTTCTTACGATTTGACGATGAGCTTCGCCCGTGGGATACAGTTCTAG
Gene >Ophcf2|06227
ATGAAGTTCACAGCCGTCTTTGCTCTTGCGATGGCCACCGTCGCCGTCGCGCAGTCTTCGACGCTCAACCGTCGC
GATAACGTGCTTCTTCCCCGCAAGGCGTGCAGCGGAACGAGGAGCGACGAGGATAAATGCAGGGGACAACGACTG
TCGCCCCAGAACTCGTTCAACAACTGGTGAGCTCTTTCTCTTTCGTCGTCATATCCGTTGAGTGAGTTTACATAC
TAAAACTCACGTCCCACTTCGCAGCAAGATCCGGGGTGGCAAGTGCTGCGCCAGGAATAAGGATGGGAGCGGTGG
GTTGGATGTTAATCGTGGTCTGGGACGCGATGATTGTGGATATTGCTTTACGGGGTCTTGCAGAGCTTAGAAGGA
AGAAGGTTTCTTACGATTTGACGATGAGCTTCGCCCGTGGGATACAGTTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail