Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06222
Gene name
Locationscaffold_07:1632421..1633733
Strand+
Gene length (bp)1312
Transcript length (bp)1185
Coding sequence length (bp)1185
Protein length (aa) 395

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 8.5E-24 136 365
PF10340 Say1_Mug180 Steryl acetyl hydrolase 8.0E-15 131 347

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06222
MQEQQEQRKQQQQPRLTATEKLMLIIRILTLAPLKLPFYAAKYALFAIRNRLPLRPYLGCAAIRFWLNDFSAREL
QYIQPGTQATYEDWARKKQKNKAKVGSSSADQQRIEPDVQPLADDGAILWIGNRKKASKVVLFFHGGGFCVPANP
GHFEWCWNAYVQTGVEAGVEVAVAFLRYSLSPGANFPVQLRQQVAALKSVLESGIGPGDIIIGGDSAGGNLVTQL
LGHILHPHSDVEAVELSGPLSGAFAVSPWLFWCDPKSQTYRTNEANDMLVATSLDKLALSFFGNRDEMRAAEGGD
NGWVAPLHVDASWFTGINGIVSTVYVTVGKREVLLEDARGLTKRLEMAGCEVRLDEADDEAHDFIYLEGAMGEVG
DATRRMKDWFGGVIRGISG*
Coding >Ophcf2|06222
ATGCAGGAGCAACAGGAGCAGCGGAAGCAGCAGCAGCAGCCTCGACTGACGGCGACGGAGAAGCTCATGCTCATC
ATCCGTATCCTGACGCTCGCCCCTCTGAAGCTTCCCTTTTACGCCGCCAAGTACGCTCTATTCGCCATCCGCAAC
AGGCTACCCCTGAGGCCGTACCTTGGATGCGCCGCAATCCGCTTCTGGTTGAACGACTTCAGCGCCCGCGAGTTG
CAGTACATTCAGCCCGGTACGCAAGCCACGTACGAAGACTGGGCGAGGAAGAAGCAGAAGAATAAAGCCAAGGTC
GGCTCGAGCTCGGCCGACCAGCAACGGATCGAGCCGGACGTACAGCCTCTCGCCGACGACGGTGCCATCCTCTGG
ATCGGGAACCGCAAGAAGGCATCCAAGGTGGTCCTCTTCTTTCACGGCGGCGGCTTCTGCGTGCCCGCCAATCCC
GGCCACTTTGAATGGTGCTGGAACGCCTACGTCCAGACGGGCGTCGAGGCCGGCGTCGAGGTAGCCGTCGCCTTC
CTACGCTACTCGCTCTCTCCGGGGGCCAACTTCCCCGTTCAGCTTCGGCAGCAGGTGGCGGCTCTCAAGTCCGTG
CTCGAGTCGGGCATCGGGCCGGGCGACATAATAATCGGGGGCGACTCGGCCGGGGGCAATCTGGTGACGCAGCTG
CTGGGCCATATACTGCACCCGCACTCGGACGTCGAAGCCGTTGAACTATCGGGGCCGCTGTCAGGTGCCTTTGCC
GTCTCTCCCTGGCTCTTCTGGTGCGACCCGAAGAGCCAGACGTATCGGACGAACGAGGCCAACGATATGCTAGTC
GCCACCAGCCTCGACAAGTTGGCGCTCAGCTTCTTTGGCAACCGTGACGAGATGCGGGCGGCCGAAGGCGGCGAC
AACGGCTGGGTGGCTCCGTTGCACGTCGACGCTTCGTGGTTCACCGGCATCAATGGCATCGTCTCAACCGTCTAC
GTGACGGTCGGCAAGAGGGAGGTGCTACTCGAAGACGCCAGGGGGTTGACGAAGCGGCTCGAGATGGCGGGCTGT
GAGGTGAGACTGGATGAGGCGGATGACGAGGCTCACGACTTTATCTATCTAGAGGGCGCGATGGGTGAGGTTGGG
GACGCGACGAGGAGGATGAAGGACTGGTTCGGGGGGGTGATTCGGGGGATCAGCGGATGA
Transcript >Ophcf2|06222
ATGCAGGAGCAACAGGAGCAGCGGAAGCAGCAGCAGCAGCCTCGACTGACGGCGACGGAGAAGCTCATGCTCATC
ATCCGTATCCTGACGCTCGCCCCTCTGAAGCTTCCCTTTTACGCCGCCAAGTACGCTCTATTCGCCATCCGCAAC
AGGCTACCCCTGAGGCCGTACCTTGGATGCGCCGCAATCCGCTTCTGGTTGAACGACTTCAGCGCCCGCGAGTTG
CAGTACATTCAGCCCGGTACGCAAGCCACGTACGAAGACTGGGCGAGGAAGAAGCAGAAGAATAAAGCCAAGGTC
GGCTCGAGCTCGGCCGACCAGCAACGGATCGAGCCGGACGTACAGCCTCTCGCCGACGACGGTGCCATCCTCTGG
ATCGGGAACCGCAAGAAGGCATCCAAGGTGGTCCTCTTCTTTCACGGCGGCGGCTTCTGCGTGCCCGCCAATCCC
GGCCACTTTGAATGGTGCTGGAACGCCTACGTCCAGACGGGCGTCGAGGCCGGCGTCGAGGTAGCCGTCGCCTTC
CTACGCTACTCGCTCTCTCCGGGGGCCAACTTCCCCGTTCAGCTTCGGCAGCAGGTGGCGGCTCTCAAGTCCGTG
CTCGAGTCGGGCATCGGGCCGGGCGACATAATAATCGGGGGCGACTCGGCCGGGGGCAATCTGGTGACGCAGCTG
CTGGGCCATATACTGCACCCGCACTCGGACGTCGAAGCCGTTGAACTATCGGGGCCGCTGTCAGGTGCCTTTGCC
GTCTCTCCCTGGCTCTTCTGGTGCGACCCGAAGAGCCAGACGTATCGGACGAACGAGGCCAACGATATGCTAGTC
GCCACCAGCCTCGACAAGTTGGCGCTCAGCTTCTTTGGCAACCGTGACGAGATGCGGGCGGCCGAAGGCGGCGAC
AACGGCTGGGTGGCTCCGTTGCACGTCGACGCTTCGTGGTTCACCGGCATCAATGGCATCGTCTCAACCGTCTAC
GTGACGGTCGGCAAGAGGGAGGTGCTACTCGAAGACGCCAGGGGGTTGACGAAGCGGCTCGAGATGGCGGGCTGT
GAGGTGAGACTGGATGAGGCGGATGACGAGGCTCACGACTTTATCTATCTAGAGGGCGCGATGGGTGAGGTTGGG
GACGCGACGAGGAGGATGAAGGACTGGTTCGGGGGGGTGATTCGGGGGATCAGCGGATGA
Gene >Ophcf2|06222
ATGGCATGTATCTCCTTGAACTCTCCTCAGAAAAACAAGCAACATAAAGACGACTAACCATGATACAAGCAGCAG
GAGCAACAGGAGCAGCGGAAGCAGCAGCAGCAGCCTCGACTGACGGCGACGGAGAAGCTCATGCTCATCATCCGT
ATCCTGACGCTCGGTACGACGCTCTCACCACCCTTGAAACGGAATCACGAACTGAACAAGCCCAAAAACAGCCCC
TCTGAAGCTTCCCTTTTACGCCGCCAAGTACGCTCTATTCGCCATCCGCAACAGGCTACCCCTGAGGCCGTACCT
TGGATGCGCCGCAATCCGCTTCTGGTTGAACGACTTCAGCGCCCGCGAGTTGCAGTACATTCAGCCCGGTACGCA
AGCCACGTACGAAGACTGGGCGAGGAAGAAGCAGAAGAATAAAGCCAAGGTCGGCTCGAGCTCGGCCGACCAGCA
ACGGATCGAGCCGGACGTACAGCCTCTCGCCGACGACGGTGCCATCCTCTGGATCGGGAACCGCAAGAAGGCATC
CAAGGTGGTCCTCTTCTTTCACGGCGGCGGCTTCTGCGTGCCCGCCAATCCCGGCCACTTTGAATGGTGCTGGAA
CGCCTACGTCCAGACGGGCGTCGAGGCCGGCGTCGAGGTAGCCGTCGCCTTCCTACGCTACTCGCTCTCTCCGGG
GGCCAACTTCCCCGTTCAGCTTCGGCAGCAGGTGGCGGCTCTCAAGTCCGTGCTCGAGTCGGGCATCGGGCCGGG
CGACATAATAATCGGGGGCGACTCGGCCGGGGGCAATCTGGTGACGCAGCTGCTGGGCCATATACTGCACCCGCA
CTCGGACGTCGAAGCCGTTGAACTATCGGGGCCGCTGTCAGGTGCCTTTGCCGTCTCTCCCTGGCTCTTCTGGTG
CGACCCGAAGAGCCAGACGTATCGGACGAACGAGGCCAACGATATGCTAGTCGCCACCAGCCTCGACAAGTTGGC
GCTCAGCTTCTTTGGCAACCGTGACGAGATGCGGGCGGCCGAAGGCGGCGACAACGGCTGGGTGGCTCCGTTGCA
CGTCGACGCTTCGTGGTTCACCGGCATCAATGGCATCGTCTCAACCGTCTACGTGACGGTCGGCAAGAGGGAGGT
GCTACTCGAAGACGCCAGGGGGTTGACGAAGCGGCTCGAGATGGCGGGCTGTGAGGTGAGACTGGATGAGGCGGA
TGACGAGGCTCACGACTTTATCTATCTAGAGGGCGCGATGGGTGAGGTTGGGGACGCGACGAGGAGGATGAAGGA
CTGGTTCGGGGGGGTGATTCGGGGGATCAGCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail