Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06221
Gene name
Locationscaffold_07:1629032..1630762
Strand-
Gene length (bp)1730
Transcript length (bp)1683
Coding sequence length (bp)1683
Protein length (aa) 561

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13434 Lys_Orn_oxgnase L-lysine 6-monooxygenase/L-ornithine 5-monooxygenase 9.7E-06 107 229
PF00743 FMO-like Flavin-binding monooxygenase-like 5.5E-07 35 223
PF13450 NAD_binding_8 NAD(P)-binding Rossmann-like domain 5.1E-06 37 86

GO

GO Term Description Terminal node
GO:0004499 N,N-dimethylaniline monooxygenase activity Yes
GO:0050661 NADP binding Yes
GO:0050660 flavin adenine dinucleotide binding Yes
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0004497 monooxygenase activity No
GO:0016491 oxidoreductase activity No
GO:0003674 molecular_function No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0036094 small molecule binding No
GO:0016709 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen No
GO:0003824 catalytic activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 31 0.5

Transmembrane Domains

Domain # Start End Length
1 538 555 17

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06221
MAQPGFQPVARPELHDYDDEEDDDDDGKATYSQFACIGVGFSGIALGATLKRWHGIQDVRFFERRPDIGGTWSVN
RYPGCAVDVPGVLYSFSFAPKFDWTGILPAAEEILGYLRRVADQYGVTARTSFNAHVIACHWRSRSRRWRLVVRY
PDEGGRIVRHDCRFLFGATGVLVDPQVPGLVGLDSFRGRCFHTSSWPADLVLSDKRVIVVGNGCTAAQVIPAIVG
QCRHLSQFIRSRQWFFQSPPKLTIPRSVHWLLAYVPGLQSLLRLFVFIVLEQSSRGYAMTVAGQRRRSYEASAAV
SLARATAPTRFHALLKPDYAPGCKRRILGSDYVRSLNAPNITVTEEPIVEVLPDGVRSRDGAFTPADVIILANGF
LTGRFLNGIDVKGSDGRTLDQHWKQFGGPEAYNCCALSHFPNMFMLLGPNTITGHTSAVMSIENSINYALRVIRP
ILDRPDAFVEVKPEAEARYSREMQRALGKTVFTSGCITWYNQEGPDGRMWNSMSYPRSQADFWYRCLFPVRRDWT
YVGAPHTTSRSKPVLLAVVVAVFGALGLLWTNRSP*
Coding >Ophcf2|06221
ATGGCCCAACCTGGATTCCAGCCCGTGGCCCGGCCGGAGCTGCACGACTATGACGACGAAGAGGACGACGACGAC
GACGGAAAGGCGACTTACAGTCAGTTCGCCTGCATAGGCGTCGGCTTCTCCGGCATCGCCCTAGGAGCAACCCTC
AAACGCTGGCACGGCATCCAAGACGTGCGCTTCTTCGAACGTCGCCCGGACATCGGAGGCACCTGGTCCGTCAAC
CGCTATCCCGGCTGCGCCGTCGATGTCCCCGGTGTTCTCTACAGCTTCTCCTTCGCCCCTAAATTTGACTGGACG
GGCATCCTTCCTGCCGCTGAAGAGATACTCGGCTATCTGCGTCGGGTGGCAGACCAGTACGGCGTCACGGCTCGG
ACCTCGTTCAACGCCCATGTCATCGCTTGTCACTGGAGGTCGCGCTCGCGACGGTGGAGGCTCGTCGTCCGATAT
CCTGATGAGGGCGGCCGCATCGTCCGACACGACTGTCGCTTTCTCTTCGGCGCCACCGGCGTCCTCGTCGATCCT
CAGGTTCCGGGCCTCGTCGGCCTCGACTCGTTTCGCGGCCGCTGCTTTCACACCTCCAGCTGGCCGGCCGACTTG
GTCCTATCCGATAAGCGAGTCATCGTCGTCGGCAACGGATGCACTGCCGCTCAGGTGATACCCGCCATCGTCGGT
CAATGCCGTCATCTGTCGCAGTTCATCCGCTCGCGCCAGTGGTTCTTCCAGTCGCCTCCCAAGCTCACCATCCCC
CGCTCAGTCCACTGGCTGCTGGCCTACGTGCCTGGTCTGCAGTCCTTACTTCGCCTTTTCGTCTTCATCGTCCTC
GAGCAGTCATCACGGGGGTATGCCATGACGGTTGCCGGTCAACGGCGTCGGTCCTACGAAGCCTCCGCCGCCGTC
TCCTTGGCCCGTGCCACGGCCCCGACCCGGTTCCACGCCTTGCTCAAGCCGGACTATGCCCCTGGCTGCAAGCGC
CGTATTCTCGGCTCCGACTACGTGCGGTCCCTCAACGCGCCCAACATCACCGTCACGGAAGAGCCCATCGTCGAG
GTGCTTCCCGATGGCGTCCGCTCCCGTGACGGCGCCTTCACACCCGCAGACGTCATCATTCTCGCCAACGGCTTC
TTGACCGGCCGCTTCCTGAATGGCATCGACGTCAAGGGCAGTGACGGTCGCACCCTCGACCAGCACTGGAAACAG
TTCGGTGGTCCAGAGGCTTACAACTGCTGCGCCTTGAGTCACTTCCCCAACATGTTCATGCTCCTCGGGCCCAAC
ACCATCACCGGACACACCTCGGCCGTCATGTCCATCGAGAACAGCATCAACTACGCGCTCCGCGTCATCCGCCCC
ATCCTCGACCGCCCGGACGCCTTCGTCGAGGTCAAGCCCGAAGCCGAGGCCCGCTATTCGCGCGAAATGCAGCGG
GCCCTGGGAAAGACCGTCTTCACATCCGGCTGCATCACCTGGTACAACCAGGAGGGCCCAGACGGACGCATGTGG
AATTCCATGTCTTATCCCCGCTCCCAGGCAGACTTTTGGTACCGCTGCCTGTTTCCCGTCCGTCGAGACTGGACC
TATGTCGGGGCGCCACATACCACCTCACGCAGTAAACCTGTCCTATTGGCCGTCGTTGTCGCTGTATTCGGCGCC
TTGGGGCTGCTGTGGACGAACAGGAGTCCCTGA
Transcript >Ophcf2|06221
ATGGCCCAACCTGGATTCCAGCCCGTGGCCCGGCCGGAGCTGCACGACTATGACGACGAAGAGGACGACGACGAC
GACGGAAAGGCGACTTACAGTCAGTTCGCCTGCATAGGCGTCGGCTTCTCCGGCATCGCCCTAGGAGCAACCCTC
AAACGCTGGCACGGCATCCAAGACGTGCGCTTCTTCGAACGTCGCCCGGACATCGGAGGCACCTGGTCCGTCAAC
CGCTATCCCGGCTGCGCCGTCGATGTCCCCGGTGTTCTCTACAGCTTCTCCTTCGCCCCTAAATTTGACTGGACG
GGCATCCTTCCTGCCGCTGAAGAGATACTCGGCTATCTGCGTCGGGTGGCAGACCAGTACGGCGTCACGGCTCGG
ACCTCGTTCAACGCCCATGTCATCGCTTGTCACTGGAGGTCGCGCTCGCGACGGTGGAGGCTCGTCGTCCGATAT
CCTGATGAGGGCGGCCGCATCGTCCGACACGACTGTCGCTTTCTCTTCGGCGCCACCGGCGTCCTCGTCGATCCT
CAGGTTCCGGGCCTCGTCGGCCTCGACTCGTTTCGCGGCCGCTGCTTTCACACCTCCAGCTGGCCGGCCGACTTG
GTCCTATCCGATAAGCGAGTCATCGTCGTCGGCAACGGATGCACTGCCGCTCAGGTGATACCCGCCATCGTCGGT
CAATGCCGTCATCTGTCGCAGTTCATCCGCTCGCGCCAGTGGTTCTTCCAGTCGCCTCCCAAGCTCACCATCCCC
CGCTCAGTCCACTGGCTGCTGGCCTACGTGCCTGGTCTGCAGTCCTTACTTCGCCTTTTCGTCTTCATCGTCCTC
GAGCAGTCATCACGGGGGTATGCCATGACGGTTGCCGGTCAACGGCGTCGGTCCTACGAAGCCTCCGCCGCCGTC
TCCTTGGCCCGTGCCACGGCCCCGACCCGGTTCCACGCCTTGCTCAAGCCGGACTATGCCCCTGGCTGCAAGCGC
CGTATTCTCGGCTCCGACTACGTGCGGTCCCTCAACGCGCCCAACATCACCGTCACGGAAGAGCCCATCGTCGAG
GTGCTTCCCGATGGCGTCCGCTCCCGTGACGGCGCCTTCACACCCGCAGACGTCATCATTCTCGCCAACGGCTTC
TTGACCGGCCGCTTCCTGAATGGCATCGACGTCAAGGGCAGTGACGGTCGCACCCTCGACCAGCACTGGAAACAG
TTCGGTGGTCCAGAGGCTTACAACTGCTGCGCCTTGAGTCACTTCCCCAACATGTTCATGCTCCTCGGGCCCAAC
ACCATCACCGGACACACCTCGGCCGTCATGTCCATCGAGAACAGCATCAACTACGCGCTCCGCGTCATCCGCCCC
ATCCTCGACCGCCCGGACGCCTTCGTCGAGGTCAAGCCCGAAGCCGAGGCCCGCTATTCGCGCGAAATGCAGCGG
GCCCTGGGAAAGACCGTCTTCACATCCGGCTGCATCACCTGGTACAACCAGGAGGGCCCAGACGGACGCATGTGG
AATTCCATGTCTTATCCCCGCTCCCAGGCAGACTTTTGGTACCGCTGCCTGTTTCCCGTCCGTCGAGACTGGACC
TATGTCGGGGCGCCACATACCACCTCACGCAGTAAACCTGTCCTATTGGCCGTCGTTGTCGCTGTATTCGGCGCC
TTGGGGCTGCTGTGGACGAACAGGAGTCCCTGA
Gene >Ophcf2|06221
ATGGCCCAACCTGGATTCCAGCCCGTGGCCCGGCCGGAGCTGCACGACTATGACGACGAAGAGGACGACGACGAC
GACGGAAAGGCGACTTACAGTCAGTTCGCCTGCATAGGCGTCGGCTTCTCCGGCATCGCCCTAGGAGCAACCCTC
AAACGCTGGCACGGCATCCAAGACGTGCGCTTCTTCGAACGTCGCCCGGACATCGGAGGCACCTGGTCCGTCAAC
CGCTATCCCGGCTGCGCCGTCGATGTCCCCGGTGTTCTCTACAGCTTCTCCTTCGCCCCTAAATTTGACTGGACG
GGCATCCTTCCTGCCGCTGAAGAGATACTCGGCTATCTGCGTCGGGTGGCAGACCAGTACGGCGTCACGGCTCGG
ACCTCGTTCAACGCCCATGTCATCGCTTGTCACTGGAGGTCGCGCTCGCGACGGTGGAGGCTCGTCGTCCGATAT
CCTGATGAGGGCGGCCGCATCGTCCGACACGACTGTCGCTTTCTCTTCGGCGCCACCGGCGTCCTCGTCGATCCT
CAGGTTCCGGGCCTCGTCGGCCTCGACTCGTTTCGCGGCCGCTGCTTTCACACCTCCAGCTGGCCGGCCGACTTG
GTCCTATCCGATAAGCGAGTCATCGTCGTCGGCAACGGATGCACTGCCGCTCAGGTGATACCCGCCATCGTCGGT
CAATGCCGTCATCTGTCGCAGTTCATCCGCTCGCGCCAGTGGTTCTTCCAGTCGCCTCCCAAGCTCACCATCCCC
CGCTCAGTCCACTGGCTGCTGGCCTACGTGCCTGGTCTGCAGTCCTTACTTCGCCTTTTCGTCTTCATCGTCCTC
GAGCAGTCATCACGGGGGTATGCCATGACGGTTGCCGGTCAACGGCGTCGGTCCTACGAAGCCTCCGCCGCCGTC
TCCTTGGCCCGTGCCACGGCCCCGACCCGGTTCCACGCCTTGCTCAAGCCGGACTATGCCCCTGGCTGCAAGCGC
CGTATTCTCGGCTCCGACTACGTGCGGTCCCTCAACGCGCCCAACATCACCGTCACGGAAGAGCCCATCGTCGAG
GTGCTTCCCGATGGCGTCCGCTCCCGTGACGGCGCCTTCACACCCGCAGACGTCATCATTCTCGCCAACGGCTTC
TTGACCGGCCGCTTCCTGAATGGCATCGACGTCAAGGGCAGTGACGGTCGCACCCTCGACCAGCACTGGAAACAG
TTCGGTGGTCCAGAGGCTTACAACTGCTGCGCCTTGAGTCACTTCCCCAACATGTTCATGCTCCTCGGGCCCAAC
ACCATCACCGGACACACCTCGGCCGTCATGTCCATCGAGAACAGCATCAACTACGCGCTCCGCGTCATCCGCCCC
ATCCTCGACCGCCCGGACGCCTTCGTCGAGGTCAAGCCCGAAGCCGAGGCCCGCTATTCGCGCGAAATGCAGCGG
GCCCTGGGAAAGACCGTCTTCACATCCGGCTGCATCACCTGGTACAACCAGGAGGGCCCAGACGGACGCATGTGG
AATTCCATGTCTTATCCCCGCTCCCAGGCAGACTTTTGGTACCGCTGCCTGTTTCCCGTCCGTCGAGACTGGACC
TATGTCGTACGTCGTCACAGACATCGTGGGGCCAAGAAGCTAACGTCTCCAAGGGGGCGCCACATACCACCTCAC
GCAGTAAACCTGTCCTATTGGCCGTCGTTGTCGCTGTATTCGGCGCCTTGGGGCTGCTGTGGACGAACAGGAGTC
CCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail