Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06220
Gene name
Locationscaffold_07:1627492..1628666
Strand+
Gene length (bp)1174
Transcript length (bp)1107
Coding sequence length (bp)1107
Protein length (aa) 369

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07542 ATP12 ATP12 chaperone protein 7.1E-36 81 227

GO

GO Term Description Terminal node
GO:0043461 proton-transporting ATP synthase complex assembly Yes
GO:0043933 protein-containing complex organization No
GO:0071840 cellular component organization or biogenesis No
GO:0070071 proton-transporting two-sector ATPase complex assembly No
GO:0065003 protein-containing complex assembly No
GO:0008150 biological_process No
GO:0009987 cellular process No
GO:0022607 cellular component assembly No
GO:0016043 cellular component organization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Mitochondrial transit peptide 0.116 0.1292 0.1072 0.0455 0.9409 0.0984 0.033 0.0525 0.0399 0.0626

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4219
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1927
Ophiocordyceps australis map64 (Brazil) OphauB2|7437
Ophiocordyceps camponoti-floridani Ophcf2|06220 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4394
Ophiocordyceps kimflemingae Ophio5|4907
Ophiocordyceps subramaniannii Hirsu2|8611

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06220
MIKARAHRLRLLPRLFHDPLLQQPRFVSLSAARPARVFPELSAGPPPKPPRPIEDHSEDRRGQKLEAGAGKDGKK
PAVPSRRFWQTVSVRLVDGHLVIYLDDRPLKHPRSKSTVQLPVSKPNLAAALAIEWERLTSAQQAAKDHLVPMTS
LICRALDIKADDDQHSSSSGGMGKIRSDITTAVLRYLDTDSLLCWAPPAGEYDTRNSKGESLREVQERFAAETVS
FLTTHIWPGVNIEPVLDGHSLTPREQAPGVREVVQDWVQGLSSWELAGLERAVLAGKSLLIGARLVTQWSEESVW
NGVPTSDDFFGVEQAAEAASIEVDWQTDRWGMVEDTHDVNYEDLRRQLGSAVLLVSGTGGDASAVFKR*
Coding >Ophcf2|06220
ATGATCAAGGCACGTGCTCATCGCCTCCGGCTTCTCCCGAGGCTCTTCCATGATCCCCTCCTGCAGCAGCCGCGC
TTCGTCTCCCTCAGCGCCGCGAGGCCGGCCAGAGTCTTTCCCGAGCTCAGCGCCGGACCGCCGCCGAAACCTCCG
AGGCCGATAGAAGACCACAGCGAGGACCGCCGCGGCCAGAAGCTCGAAGCCGGTGCGGGAAAGGATGGGAAGAAG
CCCGCCGTGCCGAGTAGGCGATTCTGGCAGACGGTGAGCGTTCGCCTGGTCGACGGCCATTTAGTAATTTACCTC
GACGACAGACCGTTGAAGCATCCGCGATCGAAATCAACGGTACAGCTACCCGTATCGAAACCCAACCTGGCGGCG
GCGCTGGCCATCGAGTGGGAACGGTTAACGTCGGCTCAGCAAGCGGCCAAAGATCATCTCGTTCCCATGACCAGT
CTCATATGTCGAGCCCTCGACATCAAGGCCGATGACGACCAGCATTCGAGCTCGTCAGGCGGCATGGGCAAGATC
CGCAGCGATATAACCACGGCTGTCCTCCGGTACCTGGACACGGACTCGCTGCTCTGCTGGGCGCCCCCGGCCGGC
GAATACGATACCCGTAACTCGAAGGGCGAGTCGCTCCGGGAGGTGCAGGAACGGTTCGCTGCAGAGACGGTGTCG
TTCCTGACGACGCACATCTGGCCGGGTGTCAATATCGAGCCGGTACTAGACGGGCACTCGTTGACGCCGCGAGAG
CAGGCGCCGGGTGTGAGGGAGGTTGTCCAGGACTGGGTGCAGGGCCTCTCCTCATGGGAGCTGGCGGGGCTGGAG
AGGGCGGTTCTCGCGGGCAAGAGTCTCCTCATCGGCGCCAGGCTCGTCACACAGTGGAGCGAGGAATCGGTATGG
AATGGTGTTCCAACCTCGGACGACTTCTTTGGCGTCGAACAGGCCGCCGAGGCTGCCAGCATCGAGGTCGACTGG
CAGACGGACCGATGGGGCATGGTGGAGGATACGCACGACGTCAACTACGAGGATTTACGAAGGCAGCTGGGCAGC
GCAGTCCTGCTCGTCTCGGGCACGGGCGGGGACGCATCGGCCGTGTTCAAACGTTAG
Transcript >Ophcf2|06220
ATGATCAAGGCACGTGCTCATCGCCTCCGGCTTCTCCCGAGGCTCTTCCATGATCCCCTCCTGCAGCAGCCGCGC
TTCGTCTCCCTCAGCGCCGCGAGGCCGGCCAGAGTCTTTCCCGAGCTCAGCGCCGGACCGCCGCCGAAACCTCCG
AGGCCGATAGAAGACCACAGCGAGGACCGCCGCGGCCAGAAGCTCGAAGCCGGTGCGGGAAAGGATGGGAAGAAG
CCCGCCGTGCCGAGTAGGCGATTCTGGCAGACGGTGAGCGTTCGCCTGGTCGACGGCCATTTAGTAATTTACCTC
GACGACAGACCGTTGAAGCATCCGCGATCGAAATCAACGGTACAGCTACCCGTATCGAAACCCAACCTGGCGGCG
GCGCTGGCCATCGAGTGGGAACGGTTAACGTCGGCTCAGCAAGCGGCCAAAGATCATCTCGTTCCCATGACCAGT
CTCATATGTCGAGCCCTCGACATCAAGGCCGATGACGACCAGCATTCGAGCTCGTCAGGCGGCATGGGCAAGATC
CGCAGCGATATAACCACGGCTGTCCTCCGGTACCTGGACACGGACTCGCTGCTCTGCTGGGCGCCCCCGGCCGGC
GAATACGATACCCGTAACTCGAAGGGCGAGTCGCTCCGGGAGGTGCAGGAACGGTTCGCTGCAGAGACGGTGTCG
TTCCTGACGACGCACATCTGGCCGGGTGTCAATATCGAGCCGGTACTAGACGGGCACTCGTTGACGCCGCGAGAG
CAGGCGCCGGGTGTGAGGGAGGTTGTCCAGGACTGGGTGCAGGGCCTCTCCTCATGGGAGCTGGCGGGGCTGGAG
AGGGCGGTTCTCGCGGGCAAGAGTCTCCTCATCGGCGCCAGGCTCGTCACACAGTGGAGCGAGGAATCGGTATGG
AATGGTGTTCCAACCTCGGACGACTTCTTTGGCGTCGAACAGGCCGCCGAGGCTGCCAGCATCGAGGTCGACTGG
CAGACGGACCGATGGGGCATGGTGGAGGATACGCACGACGTCAACTACGAGGATTTACGAAGGCAGCTGGGCAGC
GCAGTCCTGCTCGTCTCGGGCACGGGCGGGGACGCATCGGCCGTGTTCAAACGTTAG
Gene >Ophcf2|06220
ATGATCAAGGCACGTGCTCATCGCCTCCGGCTTCTCCCGAGGCTCTTCCATGATCCCCTCCTGCAGCAGCCGCGC
TTCGTCTCCCTCAGCGCCGCGAGGCCGGCCAGAGTCTTTCCCGAGCTCAGCGCCGGACCGCCGCCGAAACCTCCG
AGGCCGATAGAAGACCACAGCGAGGACCGCCGCGGCCAGAAGCTCGAAGCCGGTGCGGGAAAGGATGGGAAGAAG
CCCGCCGTGCCGAGTAGGCGATTCTGGCAGACGGTGAGCGTTCGCCTGGTCGACGGTGAGCCGGGAGACTTCTGT
GTAGAAGCAGGAGATGTGGACGTTAATGAGAGGGCGCTTGCGGCCAGGCCATTTAGTAATTTACCTCGACGACAG
ACCGTTGAAGCATCCGCGATCGAAATCAACGGTACAGCTACCCGTATCGAAACCCAACCTGGCGGCGGCGCTGGC
CATCGAGTGGGAACGGTTAACGTCGGCTCAGCAAGCGGCCAAAGATCATCTCGTTCCCATGACCAGTCTCATATG
TCGAGCCCTCGACATCAAGGCCGATGACGACCAGCATTCGAGCTCGTCAGGCGGCATGGGCAAGATCCGCAGCGA
TATAACCACGGCTGTCCTCCGGTACCTGGACACGGACTCGCTGCTCTGCTGGGCGCCCCCGGCCGGCGAATACGA
TACCCGTAACTCGAAGGGCGAGTCGCTCCGGGAGGTGCAGGAACGGTTCGCTGCAGAGACGGTGTCGTTCCTGAC
GACGCACATCTGGCCGGGTGTCAATATCGAGCCGGTACTAGACGGGCACTCGTTGACGCCGCGAGAGCAGGCGCC
GGGTGTGAGGGAGGTTGTCCAGGACTGGGTGCAGGGCCTCTCCTCATGGGAGCTGGCGGGGCTGGAGAGGGCGGT
TCTCGCGGGCAAGAGTCTCCTCATCGGCGCCAGGCTCGTCACACAGTGGAGCGAGGAATCGGTATGGAATGGTGT
TCCAACCTCGGACGACTTCTTTGGCGTCGAACAGGCCGCCGAGGCTGCCAGCATCGAGGTCGACTGGCAGACGGA
CCGATGGGGCATGGTGGAGGATACGCACGACGTCAACTACGAGGATTTACGAAGGCAGCTGGGCAGCGCAGTCCT
GCTCGTCTCGGGCACGGGCGGGGACGCATCGGCCGTGTTCAAACGTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail