Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06219
Gene name
Locationscaffold_07:1624178..1627224
Strand-
Gene length (bp)3046
Transcript length (bp)2724
Coding sequence length (bp)2724
Protein length (aa) 908

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01602 Adaptin_N Adaptin N terminal region 1.5E-104 22 541
PF08752 COP-gamma_platf Coatomer gamma subunit appendage platform subdomain 1.6E-55 641 789
PF16381 Coatomer_g_Cpla Coatomer subunit gamma-1 C-terminal appendage platform 2.4E-34 792 906
PF13646 HEAT_2 HEAT repeats 1.5E-08 468 539

GO

GO Term Description Terminal node
GO:0030126 COPI vesicle coat Yes
GO:0016192 vesicle-mediated transport Yes
GO:0006886 intracellular protein transport Yes
GO:0005198 structural molecule activity Yes
GO:0030117 membrane coat Yes
GO:0005575 cellular_component No
GO:0051234 establishment of localization No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0032991 protein-containing complex No
GO:0015031 protein transport No
GO:0003674 molecular_function No
GO:0030120 vesicle coat No
GO:0071705 nitrogen compound transport No
GO:0098796 membrane protein complex No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0051179 localization No
GO:0051641 cellular localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.5262 0.337 0.0477 0.2643 0.0635 0.013 0.1922 0.3764 0.5613 0.0069

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4218
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6727
Ophiocordyceps australis map64 (Brazil) OphauB2|7436
Ophiocordyceps camponoti-floridani Ophcf2|06219 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4393
Ophiocordyceps kimflemingae Ophio5|4906
Ophiocordyceps subramaniannii Hirsu2|8610

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06219
MSYGKKDEDADLGLVKVDRTQVFQEARLFNSSPIQPRRCRILLTKIALLLYTGEKFPANEATTLFFGISKLFQNK
DASLRQMVHLIIKELASSAEDIIMVTSTIMKDTGGSSDAIFRPNAIRALCRIIDATTVQSIERVMKTAIVDKNPS
VSSAALVSSYHLLPIAKDVVRRWQSETQEAAASTKSSGGFSLGFSSSSGQMPMNNSTMTQYHAIGLLYQMRMHDR
MALVKMVQQFGAAGAVKNPAATVMLVRLAAQLAEEDASLRKPMMQLLDGWLRHKSEMVNFEAAKAICDLRDVSDA
EVAQAVHVLQLFLSSPRAVTKFAALRILHNFASFKPSAVAACNPDIELLISNSNRSIATFAITTLLKTGNEASVD
RLMKQISGFMSEITDEFKVTIVEAIRTLCLKFPSKQAGMLTFLSGILRDEGGYEFKRAVVESMFDLIKFVPDSKE
EALAHLCEFIEDCEFTKLATVQPTKYIRYIYNRVVLENAIVRAAAVTALAKFGVGQKDPDVKSSVRVLLTRCLDD
VDDEVRDRAALNLKLMGDDNDDETAQNYVKNENMFSLPVFEHQLVMYVTSDDKSAFDDPFDVTKIPVVTREQADA
EDRTKKLTATAPTLKAPKVGPAAKAPSSGAEAAASASAQAQRYAETLMRIPEMANFGHVLKSSPVVELTEAETEY
VVTLVKHIFKEHIVLQYEVKNTLPDTVLENVSVVATPSEEEELEEEFIIPAERLVTNEPGNVYVAFKKVNGGSAL
PVTSVSNILKFTSKEIDPTTNEPEETGYDDEYEVSEFDLAGSDYLVPTFASNFNHLWEQIGASGEQAEETLQLSG
MKSIAEATEQLARTLSLQPLDGTDVPVNQSTHTLKLLGKTVLGGRVVATVRMAYSSKSGVTTKIQVRSEEDNVAA
LVLTSVA*
Coding >Ophcf2|06219
ATGAGCTACGGGAAAAAGGACGAGGATGCAGACCTGGGCCTGGTCAAGGTCGACCGCACGCAGGTCTTCCAGGAA
GCCCGCCTGTTCAACAGCTCGCCCATTCAGCCGCGACGATGTCGCATCCTGCTCACCAAGATCGCTCTCCTCCTC
TATACGGGGGAGAAGTTCCCAGCCAATGAGGCCACCACGCTCTTCTTCGGCATCTCCAAGCTCTTCCAGAATAAG
GATGCCAGTCTACGGCAGATGGTCCACCTTATTATCAAGGAGCTGGCCAGCTCGGCCGAGGACATCATCATGGTC
ACCAGCACCATCATGAAGGATACCGGCGGCAGCAGCGATGCCATCTTTCGCCCAAATGCTATCCGCGCTCTGTGT
CGTATCATCGACGCGACGACCGTGCAATCCATCGAACGCGTCATGAAGACTGCCATCGTGGATAAGAACCCTTCG
GTGTCTTCCGCCGCTTTGGTCTCGTCCTACCACCTCCTGCCCATCGCAAAGGATGTCGTGCGCCGTTGGCAAAGC
GAGACGCAAGAGGCTGCCGCCTCCACCAAGTCCTCCGGCGGCTTCTCCCTCGGCTTCTCCTCCTCGAGCGGCCAG
ATGCCCATGAACAACTCCACCATGACGCAGTATCACGCCATCGGCCTGCTGTACCAGATGCGGATGCACGACAGG
ATGGCTCTCGTTAAGATGGTGCAGCAGTTTGGCGCCGCCGGCGCGGTCAAAAATCCGGCCGCCACCGTCATGCTC
GTTCGTCTCGCGGCTCAGCTGGCTGAGGAGGACGCGTCGTTGCGGAAGCCCATGATGCAGCTCCTCGACGGCTGG
TTGCGTCACAAGAGCGAAATGGTCAACTTTGAGGCCGCCAAGGCCATCTGTGATCTGAGGGACGTGTCCGACGCC
GAGGTCGCACAGGCAGTTCACGTTTTGCAGCTCTTCCTGTCGTCGCCGCGGGCCGTCACCAAGTTCGCCGCCCTC
CGCATCCTGCACAACTTTGCCTCTTTCAAGCCCAGCGCCGTGGCCGCCTGCAACCCGGACATTGAGCTCCTCATC
TCCAACAGCAATAGGTCCATCGCCACATTCGCCATCACCACGCTTCTCAAGACGGGCAACGAGGCCAGCGTGGAT
CGGCTGATGAAGCAGATCTCGGGTTTCATGTCGGAAATCACCGACGAGTTCAAGGTCACCATCGTCGAGGCCATC
CGCACTCTGTGCCTCAAGTTCCCGAGCAAGCAGGCCGGCATGTTGACCTTCCTCAGCGGCATTCTTCGCGACGAG
GGCGGTTACGAGTTCAAGCGCGCCGTCGTAGAGAGCATGTTTGACCTCATCAAGTTCGTGCCGGATTCCAAGGAA
GAGGCCCTAGCCCATCTCTGCGAATTCATCGAGGACTGCGAGTTCACCAAACTCGCCACGGTTCAGCCGACCAAG
TACATCCGCTACATCTACAACCGTGTGGTGCTGGAGAACGCCATCGTCAGGGCCGCGGCCGTCACCGCTCTGGCC
AAGTTCGGTGTTGGTCAGAAGGATCCCGACGTCAAGTCGAGCGTCAGGGTGTTGCTCACTCGCTGCCTCGACGAT
GTCGACGACGAGGTCCGCGATCGCGCCGCCCTGAACCTGAAGCTCATGGGCGACGACAATGACGACGAGACGGCG
CAGAACTATGTCAAGAATGAAAACATGTTCTCCCTTCCCGTCTTCGAGCATCAACTCGTCATGTACGTCACTTCG
GACGACAAGTCGGCCTTTGACGACCCCTTCGACGTGACAAAGATTCCAGTCGTCACCCGTGAGCAGGCCGACGCC
GAGGACAGGACGAAGAAGTTGACGGCGACGGCGCCTACGCTCAAGGCGCCCAAGGTCGGCCCGGCCGCCAAGGCT
CCTTCGAGCGGCGCCGAGGCTGCTGCGTCGGCTTCCGCTCAGGCGCAGCGCTACGCCGAGACGCTGATGCGGATT
CCGGAGATGGCCAACTTTGGCCACGTGCTCAAGTCGTCGCCGGTGGTGGAGCTGACGGAGGCAGAGACGGAGTAC
GTGGTGACGCTGGTCAAGCACATCTTCAAGGAGCACATCGTCCTCCAATACGAGGTGAAGAACACGCTGCCCGAC
ACGGTGCTGGAGAACGTGTCTGTCGTGGCCACGCCGTCCGAGGAGGAGGAGCTCGAGGAGGAGTTCATCATCCCC
GCCGAACGGCTGGTGACCAACGAGCCGGGCAATGTCTACGTGGCCTTCAAGAAGGTCAACGGCGGGTCGGCGCTG
CCCGTCACGTCGGTCTCCAACATTCTCAAGTTCACCAGCAAGGAGATCGACCCGACGACCAACGAGCCGGAAGAG
ACGGGCTACGATGACGAGTACGAGGTGTCCGAGTTCGACCTCGCCGGTAGCGACTACCTGGTGCCGACGTTTGCC
AGCAACTTTAACCACCTGTGGGAGCAGATCGGCGCCTCGGGCGAGCAGGCCGAGGAGACGCTGCAGCTGAGCGGC
ATGAAGAGCATTGCAGAGGCGACGGAGCAGCTGGCAAGGACCTTGTCGCTGCAGCCGTTGGACGGTACCGACGTA
CCCGTCAACCAGAGCACCCACACGCTCAAGCTTCTGGGCAAGACAGTCCTCGGAGGCAGGGTGGTGGCCACGGTG
CGGATGGCGTATTCGTCCAAGTCGGGCGTCACGACGAAGATCCAGGTGCGGAGCGAGGAGGACAACGTGGCGGCC
TTGGTGCTCACTTCCGTGGCATGA
Transcript >Ophcf2|06219
ATGAGCTACGGGAAAAAGGACGAGGATGCAGACCTGGGCCTGGTCAAGGTCGACCGCACGCAGGTCTTCCAGGAA
GCCCGCCTGTTCAACAGCTCGCCCATTCAGCCGCGACGATGTCGCATCCTGCTCACCAAGATCGCTCTCCTCCTC
TATACGGGGGAGAAGTTCCCAGCCAATGAGGCCACCACGCTCTTCTTCGGCATCTCCAAGCTCTTCCAGAATAAG
GATGCCAGTCTACGGCAGATGGTCCACCTTATTATCAAGGAGCTGGCCAGCTCGGCCGAGGACATCATCATGGTC
ACCAGCACCATCATGAAGGATACCGGCGGCAGCAGCGATGCCATCTTTCGCCCAAATGCTATCCGCGCTCTGTGT
CGTATCATCGACGCGACGACCGTGCAATCCATCGAACGCGTCATGAAGACTGCCATCGTGGATAAGAACCCTTCG
GTGTCTTCCGCCGCTTTGGTCTCGTCCTACCACCTCCTGCCCATCGCAAAGGATGTCGTGCGCCGTTGGCAAAGC
GAGACGCAAGAGGCTGCCGCCTCCACCAAGTCCTCCGGCGGCTTCTCCCTCGGCTTCTCCTCCTCGAGCGGCCAG
ATGCCCATGAACAACTCCACCATGACGCAGTATCACGCCATCGGCCTGCTGTACCAGATGCGGATGCACGACAGG
ATGGCTCTCGTTAAGATGGTGCAGCAGTTTGGCGCCGCCGGCGCGGTCAAAAATCCGGCCGCCACCGTCATGCTC
GTTCGTCTCGCGGCTCAGCTGGCTGAGGAGGACGCGTCGTTGCGGAAGCCCATGATGCAGCTCCTCGACGGCTGG
TTGCGTCACAAGAGCGAAATGGTCAACTTTGAGGCCGCCAAGGCCATCTGTGATCTGAGGGACGTGTCCGACGCC
GAGGTCGCACAGGCAGTTCACGTTTTGCAGCTCTTCCTGTCGTCGCCGCGGGCCGTCACCAAGTTCGCCGCCCTC
CGCATCCTGCACAACTTTGCCTCTTTCAAGCCCAGCGCCGTGGCCGCCTGCAACCCGGACATTGAGCTCCTCATC
TCCAACAGCAATAGGTCCATCGCCACATTCGCCATCACCACGCTTCTCAAGACGGGCAACGAGGCCAGCGTGGAT
CGGCTGATGAAGCAGATCTCGGGTTTCATGTCGGAAATCACCGACGAGTTCAAGGTCACCATCGTCGAGGCCATC
CGCACTCTGTGCCTCAAGTTCCCGAGCAAGCAGGCCGGCATGTTGACCTTCCTCAGCGGCATTCTTCGCGACGAG
GGCGGTTACGAGTTCAAGCGCGCCGTCGTAGAGAGCATGTTTGACCTCATCAAGTTCGTGCCGGATTCCAAGGAA
GAGGCCCTAGCCCATCTCTGCGAATTCATCGAGGACTGCGAGTTCACCAAACTCGCCACGGTTCAGCCGACCAAG
TACATCCGCTACATCTACAACCGTGTGGTGCTGGAGAACGCCATCGTCAGGGCCGCGGCCGTCACCGCTCTGGCC
AAGTTCGGTGTTGGTCAGAAGGATCCCGACGTCAAGTCGAGCGTCAGGGTGTTGCTCACTCGCTGCCTCGACGAT
GTCGACGACGAGGTCCGCGATCGCGCCGCCCTGAACCTGAAGCTCATGGGCGACGACAATGACGACGAGACGGCG
CAGAACTATGTCAAGAATGAAAACATGTTCTCCCTTCCCGTCTTCGAGCATCAACTCGTCATGTACGTCACTTCG
GACGACAAGTCGGCCTTTGACGACCCCTTCGACGTGACAAAGATTCCAGTCGTCACCCGTGAGCAGGCCGACGCC
GAGGACAGGACGAAGAAGTTGACGGCGACGGCGCCTACGCTCAAGGCGCCCAAGGTCGGCCCGGCCGCCAAGGCT
CCTTCGAGCGGCGCCGAGGCTGCTGCGTCGGCTTCCGCTCAGGCGCAGCGCTACGCCGAGACGCTGATGCGGATT
CCGGAGATGGCCAACTTTGGCCACGTGCTCAAGTCGTCGCCGGTGGTGGAGCTGACGGAGGCAGAGACGGAGTAC
GTGGTGACGCTGGTCAAGCACATCTTCAAGGAGCACATCGTCCTCCAATACGAGGTGAAGAACACGCTGCCCGAC
ACGGTGCTGGAGAACGTGTCTGTCGTGGCCACGCCGTCCGAGGAGGAGGAGCTCGAGGAGGAGTTCATCATCCCC
GCCGAACGGCTGGTGACCAACGAGCCGGGCAATGTCTACGTGGCCTTCAAGAAGGTCAACGGCGGGTCGGCGCTG
CCCGTCACGTCGGTCTCCAACATTCTCAAGTTCACCAGCAAGGAGATCGACCCGACGACCAACGAGCCGGAAGAG
ACGGGCTACGATGACGAGTACGAGGTGTCCGAGTTCGACCTCGCCGGTAGCGACTACCTGGTGCCGACGTTTGCC
AGCAACTTTAACCACCTGTGGGAGCAGATCGGCGCCTCGGGCGAGCAGGCCGAGGAGACGCTGCAGCTGAGCGGC
ATGAAGAGCATTGCAGAGGCGACGGAGCAGCTGGCAAGGACCTTGTCGCTGCAGCCGTTGGACGGTACCGACGTA
CCCGTCAACCAGAGCACCCACACGCTCAAGCTTCTGGGCAAGACAGTCCTCGGAGGCAGGGTGGTGGCCACGGTG
CGGATGGCGTATTCGTCCAAGTCGGGCGTCACGACGAAGATCCAGGTGCGGAGCGAGGAGGACAACGTGGCGGCC
TTGGTGCTCACTTCCGTGGCATGA
Gene >Ophcf2|06219
ATGAGCTACGGGAAAAAGGACGAGGATGCAGACCTGGGCCTGGTCAAGGTCGACCGCACGCAGGTCTTCCAGGAA
GGTGAGAAGCAGATGATGGCTGTCGCCGCCCTTGACGATGACACTCACTCACGCGTCGCATCGCAGCCCGCCTGT
TCAACAGCTCGCCCATTCAGCCGCGACGATGTCGCATCCTGCTCACCAAGATCGCTCTCCTCCTCTATACGGGGG
AGAAGTTCCCAGCCAATGAGGCCACCACGCTCTTCTTCGGCATCTCCAAGCTCTTCCAGAATAAGGATGCCAGTC
TACGGCAGATGGTCCACCTTATTATCAAGGAGCTGGCCAGCTCGGCCGAGGACATCATCATGGTCACCAGCACCA
TCATGAAGGATACCGGCGGCAGCAGCGATGCCATCTTTCGCCCAAATGCTATCCGCGCTCTGTGTCGTATCATCG
ACGTGCGTGACCGCTTATAACCAGAAAGACCCAGATCAAATTGCTGACGCGAGACATACTCGCTAGGCGACGACC
GTGCAATCCATCGAACGCGTCATGAAGACTGCCATCGTGGATAAGAACCCTTCGGTGTCTTCCGCCGCTTTGGTC
TCGTCCTACCACCTCCTGCCCATCGCAAAGGATGTCGTGCGCCGTTGGCAAAGCGAGACGCAAGAGGCTGCCGCC
TCCACCAAGTCCTCCGGCGGCTTCTCCCTCGGCTTCTCCTCCTCGAGCGGCCAGATGCCCATGAACAACTCCACC
ATGACGCAGTATCACGCCATCGGCCTGCTGTACCAGATGCGGATGCACGACAGGATGGCTCTCGTTAAGATGGTG
CAGCAGTTTGGCGCCGCCGGCGCGGTCAAAAATCCGGCCGCCACCGTCATGCTCGTTCGTCTCGCGGCTCAGCTG
GCTGAGGAGGACGCGTCGTTGCGGAAGCCCATGATGCAGCTCCTCGACGGCTGGTTGCGTCACAAGAGCGAAATG
GTCAACTTTGAGGCCGCCAAGGCCATCTGTGATCTGAGGGACGTGTCCGACGCCGAGGTCGCACAGGCAGTTCAC
GTTTTGCAGCTCTTCCTGTCGTCGCCGCGGGCCGTCACCAAGTTCGCCGCCCTCCGCATCCTGCACAACTTTGCC
TCTTTCAAGCCCAGCGCCGTGGCCGCCTGCAACCCGGACATTGAGCTCCTCATCTCCAACAGCAATAGGTCCATC
GCCACATTCGCCATCACCACGCTTCTCAAGACGGGCAACGAGGCCAGCGTGGATCGGCTGATGAAGCAGATCTCG
GGTTTCATGTCGGAAATCACCGACGAGTTCAAGGTCACCATCGTCGAGGCCATCCGCACTCTGTGCCTCAAGTTC
CCGAGCAAGCAGGCCGGCATGTTGACCTTCCTCAGCGGCATTCTTCGCGACGAGGGCGGTTACGAGTTCAAGCGC
GCCGTCGTAGAGAGCATGTTTGACCTCATCAAGTTCGTGCCGGATTCCAAGGAAGAGGCCCTAGCCCATCTCTGC
GAATTCATCGAGGACTGCGAGTTCACCAAACTCGCCGTCCGTATACTGCACCTCATCGGGCTCGAAGGGCCCGTA
TACTGCACCTCATCGGGCTCGAAGGGCCCAAGACGGTTCAGCCGACCAAGTACATCCGCTACATCTACAACCGTG
TGGTGCTGGAGAACGCCATCGTCAGGGCCGCGGCCGTCACCGCTCTGGCCAAGTTCGGTGTTGGTCAGAAGGATC
CCGACGTCAAGTCGAGCGTCAGGGTGTTGCTCACTCGCTGCCTCGACGATGTCGACGACGAGGTCCGCGATCGCG
CCGCCCTGAACCTGAAGCTCATGGGCGACGACAATGACGACGAGACGGCGCAGAACTATGTCAAGAATGGCAAGC
CTTTTCATCATCCCTGACGCATCCTCACGACGGCTAACACCAAGCTTCCATAGAAAACATGTTCTCCCTTCCCGT
CTTCGAGCATCAACTCGTCATGTACGTCACTTCGGACGACAAGTCGGCCTTTGACGACCCCTTCGACGTGACAAA
GATTCCAGTCGTCACCCGTGAGCAGGCCGACGCCGAGGACAGGACGAAGAAGTTGACGGCGACGGCGCCTACGCT
CAAGGCGCCCAAGGTCGGCCCGGCCGCCAAGGCTCCTTCGAGCGGCGCCGAGGCTGCTGCGTCGGCTTCCGCTCA
GGCGCAGCGCTACGCCGAGACGCTGATGCGGATTCCGGAGATGGCCAACTTTGGCCACGTGCTCAAGTCGTCGCC
GGTGGTGGAGCTGACGGAGGCAGAGACGGAGTACGTGGTGACGCTGGTCAAGCACATCTTCAAGGAGCACATCGT
CCTCCAATACGAGGTGAAGAACACGCTGCCCGACACGGTGCTGGAGAACGTGTCTGTCGTGGCCACGCCGTCCGA
GGAGGAGGAGCTCGAGGAGGAGTTCATCATCCCCGCCGAACGGCTGGTGACCAACGAGCCGGGCAATGTCTACGT
GGCCTTCAAGAAGGTCAACGGCGGGTCGGCGCTGCCCGTCACGTCGGTCTCCAACATTCTCAAGTTCACCAGCAA
GGAGATCGACCCGACGACCAACGAGCCGGAAGAGACGGGCTACGATGACGAGTACGAGGTGTCCGAGTTCGACCT
CGCCGGTAGCGACTACCTGGTGCCGACGTTTGCCAGCAACTTTAACCACCTGTGGGAGCAGATCGGCGCCTCGGG
CGAGCAGGCCGAGGAGACGCTGCAGCTGAGCGGCATGAAGAGCATTGCAGGCGAGTACCACTTGGTGGCGCACCG
GTCCGGGACTGCGGCTGACTCGGCATGGATTGAAACAGAGGCGACGGAGCAGCTGGCAAGGACCTTGTCGCTGCA
GCCGTTGGACGGTACCGACGTACCCGTCAACCAGAGCACCCACACGCTCAAGCTTCTGGGCAAGACAGTCCTCGG
AGGCAGGGTGGTGGCCACGGTGCGGATGGCGTATTCGTCCAAGTCGGGCGTCACGACGAAGATCCAGGTGCGGAG
CGAGGAGGACAACGTGGCGGCCTTGGTGCTCACTTCCGTGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail