Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06210
Gene name
Locationscaffold_07:1599983..1603206
Strand+
Gene length (bp)3223
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00009 GTP_EFTU Elongation factor Tu GTP binding domain 6.9E-45 58 271
PF03143 GTP_EFTU_D3 Elongation factor Tu C-terminal domain 9.0E-32 372 478
PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2 5.0E-15 297 362

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0003924 GTPase activity Yes
GO:0003824 catalytic activity No
GO:0016462 pyrophosphatase activity No
GO:0097159 organic cyclic compound binding No
GO:0019001 guanyl nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0000166 nucleotide binding No
GO:0036094 small molecule binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0043167 ion binding No
GO:0097367 carbohydrate derivative binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6677 0.3994 0.0762 0.1659 0.2556 0.0544 0.2557 0.0222 0.1187 0.1007

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1823
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5626
Ophiocordyceps australis map64 (Brazil) OphauB2|7403
Ophiocordyceps camponoti-floridani Ophcf2|06210 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2749
Ophiocordyceps kimflemingae Ophio5|6165
Ophiocordyceps subramaniannii Hirsu2|1799

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06210
MRRYSTIEHDWMVVSTCHPTCGFFHSPTSNTLDTPFKPSSTVKMGKDEKIHINVVVIGYSTTTGHLIYQCGGIDK
RTIEKFEKEAAELGKGSFKYAWVLDKLKAERERGITIDIALWKFETPKYYVTVIDAPGHRDFIKNMITGTSQADC
AILIIAAGTGEFEAGISKDGQTREHALLAYTLGVKQLIVAINKMDTAKWAQSRYEEIIKETSNFIKKVGYNPKTV
PFVPISGFNGDNMLAASSNCPWYKGWEKETKAGKSTGKTLLEALDAIEPPKRPVDKPLRLPLQDVYKIGGIGTVP
VGRIETGVIKPGMVVTFAPSNVTTEVKSVEMHHEQLTEGVPGDNVGFNVKNVSVKEIRRGNVAGDSKNDPPMAAA
SFDAQVIVLNHPGQVGAGYAPVLDCHTAHIACKFAEIKEKIDRRTGKAVEAAPKFIKSGDSAIVKMVPSKPMCVE
AFTDYPPLGRFAVRDMRQTVAVGVIKSVEKTSGAAGKVTKSAAKAAKK*
Coding >Ophcf2|06210
ATGCGACGGTATTCAACAATCGAGCACGACTGGATGGTGGTTTCGACTTGTCATCCGACCTGCGGTTTTTTTCAC
TCCCCGACAAGCAATACACTTGACACACCTTTCAAACCCTCATCCACCGTCAAAATGGGCAAGGACGAGAAGATT
CACATCAACGTGGTCGTCATCGGGTACTCTACTACCACCGGTCACTTGATCTACCAATGCGGTGGTATCGACAAG
CGTACCATTGAGAAGTTCGAGAAGGAAGCCGCCGAACTTGGCAAGGGTTCCTTCAAGTACGCCTGGGTTCTTGAC
AAGCTCAAGGCTGAGCGCGAGCGTGGTATCACCATCGACATTGCCCTCTGGAAGTTTGAGACTCCCAAGTACTAT
GTCACCGTCATCGACGCTCCCGGCCACCGTGACTTCATCAAGAACATGATCACTGGCACCTCTCAGGCCGACTGC
GCCATCCTCATCATTGCCGCCGGCACTGGTGAGTTCGAGGCTGGTATCTCCAAGGATGGCCAGACCCGAGAGCAC
GCCCTGCTCGCCTACACCCTCGGTGTGAAGCAGCTCATCGTCGCCATCAACAAGATGGACACCGCCAAGTGGGCC
CAGTCCCGTTACGAGGAAATCATCAAGGAGACTTCCAACTTCATCAAGAAGGTCGGCTACAACCCCAAGACTGTC
CCCTTCGTTCCCATCTCCGGCTTCAACGGCGACAACATGCTTGCCGCTTCCTCCAACTGCCCCTGGTACAAGGGC
TGGGAGAAGGAGACCAAGGCCGGCAAGTCCACTGGCAAGACGCTCCTCGAGGCCCTCGACGCCATTGAGCCTCCC
AAACGTCCTGTCGACAAGCCTCTCCGCCTTCCCCTCCAGGACGTCTACAAGATTGGCGGTATCGGCACAGTCCCT
GTCGGCCGTATCGAGACTGGTGTCATCAAGCCCGGCATGGTCGTCACCTTCGCCCCCTCCAACGTCACCACTGAA
GTCAAGTCGGTCGAGATGCACCACGAGCAGCTGACCGAGGGTGTTCCCGGCGACAACGTCGGCTTCAACGTCAAG
AACGTCTCCGTCAAGGAGATCCGTCGTGGCAACGTCGCCGGTGACTCCAAGAACGACCCTCCCATGGCCGCCGCC
TCTTTCGATGCCCAGGTCATCGTTCTGAACCACCCCGGCCAGGTCGGTGCCGGCTACGCTCCCGTTCTCGACTGC
CACACCGCCCACATCGCCTGCAAGTTCGCCGAGATCAAGGAGAAGATTGACCGTCGTACTGGCAAGGCTGTCGAG
GCTGCTCCCAAGTTCATCAAGTCGGGCGACTCTGCCATCGTCAAGATGGTCCCCTCCAAGCCCATGTGCGTCGAG
GCCTTCACTGACTACCCTCCGCTGGGTCGTTTCGCCGTCCGTGACATGCGTCAGACCGTCGCTGTCGGTGTCATC
AAGTCGGTTGAGAAGACCAGCGGTGCCGCCGGTAAGGTGACTAAGTCTGCCGCCAAGGCTGCCAAGAAATAA
Transcript >Ophcf2|06210
ATGCGACGGTATTCAACAATCGAGCACGACTGGATGGTGGTTTCGACTTGTCATCCGACCTGCGGTTTTTTTCAC
TCCCCGACAAGCAATACACTTGACACACCTTTCAAACCCTCATCCACCGTCAAAATGGGCAAGGACGAGAAGATT
CACATCAACGTGGTCGTCATCGGGTACTCTACTACCACCGGTCACTTGATCTACCAATGCGGTGGTATCGACAAG
CGTACCATTGAGAAGTTCGAGAAGGAAGCCGCCGAACTTGGCAAGGGTTCCTTCAAGTACGCCTGGGTTCTTGAC
AAGCTCAAGGCTGAGCGCGAGCGTGGTATCACCATCGACATTGCCCTCTGGAAGTTTGAGACTCCCAAGTACTAT
GTCACCGTCATCGACGCTCCCGGCCACCGTGACTTCATCAAGAACATGATCACTGGCACCTCTCAGGCCGACTGC
GCCATCCTCATCATTGCCGCCGGCACTGGTGAGTTCGAGGCTGGTATCTCCAAGGATGGCCAGACCCGAGAGCAC
GCCCTGCTCGCCTACACCCTCGGTGTGAAGCAGCTCATCGTCGCCATCAACAAGATGGACACCGCCAAGTGGGCC
CAGTCCCGTTACGAGGAAATCATCAAGGAGACTTCCAACTTCATCAAGAAGGTCGGCTACAACCCCAAGACTGTC
CCCTTCGTTCCCATCTCCGGCTTCAACGGCGACAACATGCTTGCCGCTTCCTCCAACTGCCCCTGGTACAAGGGC
TGGGAGAAGGAGACCAAGGCCGGCAAGTCCACTGGCAAGACGCTCCTCGAGGCCCTCGACGCCATTGAGCCTCCC
AAACGTCCTGTCGACAAGCCTCTCCGCCTTCCCCTCCAGGACGTCTACAAGATTGGCGGTATCGGCACAGTCCCT
GTCGGCCGTATCGAGACTGGTGTCATCAAGCCCGGCATGGTCGTCACCTTCGCCCCCTCCAACGTCACCACTGAA
GTCAAGTCGGTCGAGATGCACCACGAGCAGCTGACCGAGGGTGTTCCCGGCGACAACGTCGGCTTCAACGTCAAG
AACGTCTCCGTCAAGGAGATCCGTCGTGGCAACGTCGCCGGTGACTCCAAGAACGACCCTCCCATGGCCGCCGCC
TCTTTCGATGCCCAGGTCATCGTTCTGAACCACCCCGGCCAGGTCGGTGCCGGCTACGCTCCCGTTCTCGACTGC
CACACCGCCCACATCGCCTGCAAGTTCGCCGAGATCAAGGAGAAGATTGACCGTCGTACTGGCAAGGCTGTCGAG
GCTGCTCCCAAGTTCATCAAGTCGGGCGACTCTGCCATCGTCAAGATGGTCCCCTCCAAGCCCATGTGCGTCGAG
GCCTTCACTGACTACCCTCCGCTGGGTCGTTTCGCCGTCCGTGACATGCGTCAGACCGTCGCTGTCGGTGTCATC
AAGTCGGTTGAGAAGACCAGCGGTGCCGCCGGTAAGGTGACTAAGTCTGCCGCCAAGGCTGCCAAGAAATAA
Gene >Ophcf2|06210
ATGCGACGGTATTCAACAATCGAGCACGACTGGATGGTGGTTTCGACTTGTGTAGCATTAAACTGAGAAGCTCTC
GACGAGCATCAAAACGAACTACCCCAGCACCACCAAATCCCTTGTCAATCCCAACACGATGCTCGACACAGACGC
AAGGCTGGCTCATTGGCAGACGACCACTGGCCGTCGTCAACCGGCCGCTCTAGCGGCTGCTGCAGTTCGCATTGG
CGCCGAGAGGAAAAGAAAGGGAGCGGGCGCGGGCGCTGAGACACAAGCCGTACAAAAGCAGGCCTCGTGTCATGC
GTCTCTGTCTGGATCCTCGTCGATTGTTGTTCGGGCTCGAGGTTGGGCATGGCGATCGGGCCAGATTCTACGGAG
CAGCGCTGCTTCGTTTTTTTTTTTTTTCCGATTTTTTTTTTTTTTTATCCAAATCATCGCGGTCGATGGATCGGG
CGCCACTTATATGTATGTACGAATATCCGTCGTTTGCTAACAGACGTCATGTATCGCGCCAACCCAAACCTCCAC
TATGACTCCTTGACAGCCTACCTAGGTAGGTACATACAGGTACCTACATAGGCTTGGAGTCATGCTGGATATTGA
CCGTGACGAAGCCCTCCCCTTGCTGTCCACACTTTCATCCTTTGATGATCGCCTGTAGGCTGTATGCATGTATGC
ATGATGTATGTATGACTCGACGACCGCGCAGACCCTGAGCCTCTCCCCATCCCCAGAGACGTGACTGGCTCCCCA
GACCGGAAAAGTGGCAAGCCCCTGGACCAAAGCATCGAGCTAGAAGGGGTGGCCGGACATGAGCTTGCTTACTAA
GGCGAGAGAAAAACCTCGGCCCTGTTAGGGCTGCCCCTCCCACAAAGAAAGAAAAAAAATTGCCCCTCTCTTGGT
TGCCCCGCGCCTGATAGTGGCCACCCCTCCTTTGCCCACCCTTTTAAATCTCCTCCGCCCACCAACGGCTTGCGA
ATTTTTCTCCCTTTCGCTCTTCGTCTCGCATACCCGGTTCAAGCATCCGACCTGCGGTTTTTGTAAGTTGCCTCT
GGTTCTCGCCTCCTCTCGTCCCGCCTGTCGCTCCTTCATCATCCTCTTCATCCTTCATCGTCATCTTCATCGTCA
TCTTCATCGCCGTTTTGGCATCGTGCTTGCCATCGTCGCTGGCCGTTGGCTAACGCTCGCAGTTCACTCCCCGAC
AAGCAATACACTTGACACACCTTTCAAACCCTCATCCACCGTCAAAATGGGGTACGTCGGCCTCGCTGATCCGTG
AGCCATGGCCATGTATTGACTGTCGCGCAGCAAGGACGAGAAGATTCACATCAACGTGGTCGTCATCGTATGTTG
CTCACCTCCCCGTCTTCCATCGCGTTTCGTCTGCTAACTCATCTCTCAGGGGTACGTAGAACATCTCGATTCTTA
CCTGTCGCGACGACGACGCTGACCTCTATCCAGCCACGTCGACTCCGGCAAGTCTACTACCGTGAGTTTTCCTGT
CTTGGCGGCGGCCGTGACATCCGGCTGCCGCTACCCCGCTTGGCCTGTCACCGTGAAATTGCCATTCTAACTCTT
GAGCAGACCGGTCACTTGATCTACCAATGCGGTGGTATCGACAAGCGTACCATTGAGAAGTTCGAGAAGGTAAGT
TTCTCTCTTTGTCCTACGTCTTGTGTTTTTCCCTCCTCGCCTCAATTTCCCACATCGAAGGCCTCGTGTCCGAAG
TGTCTCACTACCCCCACCTTGCACGAGAACCCCAAAAAATTTCAGCCCTGTTTTTTCTTTCTTTCTTTTTTTCTT
GCCCCTTGTGGCAGTGGGGCCCTATCCCCTGCAGAGCCCCCTCACTCAGAAGCCCCACGAATGATGCGACCGCGA
TTGCACCCACGATGGTAGGGAAAATTCACTGACAGCTCCAAAAGGAAGCCGCCGAACTTGGCAAGGGTTCCTTCA
AGTACGCCTGGGTTCTTGACAAGCTCAAGGCTGAGCGCGAGCGTGGTATCACCATCGACATTGCCCTCTGGAAGT
TTGAGACTCCCAAGTACTATGTCACCGTCATCGGTACGTTTTGTCCTTGCTCGGCTCTTGGTATCTGGCTCGACT
GACCGTGGTCGCAGACGCTCCCGGCCACCGTGACTTCATCAAGAACATGATCACTGGCACCTCTCAGGCCGACTG
CGCCATCCTCATCATTGCCGCCGGCACTGGTGAGTTCGAGGCTGGTATCTCCAAGGATGGCCAGACCCGAGAGCA
CGCCCTGCTCGCCTACACCCTCGGTGTGAAGCAGCTCATCGTCGCCATCAACAAGATGGACACCGCCAAGTGGGC
CCAGTCCCGTTACGAGGAAATCATCAAGGAGACTTCCAACTTCATCAAGAAGGTCGGCTACAACCCCAAGACTGT
CCCCTTCGTTCCCATCTCCGGCTTCAACGGCGACAACATGCTTGCCGCTTCCTCCAACTGCCCCTGGTACAAGGG
CTGGGAGAAGGAGACCAAGGCCGGCAAGTCCACTGGCAAGACGCTCCTCGAGGCCCTCGACGCCATTGAGCCTCC
CAAACGTCCTGTCGACAAGCCTCTCCGCCTTCCCCTCCAGGACGTCTACAAGATTGGCGGTATCGGCACAGTCCC
TGTCGGCCGTATCGAGACTGGTGTCATCAAGCCCGGCATGGTCGTCACCTTCGCCCCCTCCAACGTCACCACTGA
AGTCAAGTCGGTCGAGATGCACCACGAGCAGCTGACCGAGGGTGTTCCCGGCGACAACGTCGGCTTCAACGTCAA
GAACGTCTCCGTCAAGGAGATCCGTCGTGGCAACGTCGCCGGTGACTCCAAGAACGACCCTCCCATGGCCGCCGC
CTCTTTCGATGCCCAGGTCATCGTTCTGAACCACCCCGGCCAGGTCGGTGCCGGCTACGCTCCCGTTCTCGACTG
CCACACCGCCCACATCGCCTGCAAGTTCGCCGAGATCAAGGAGAAGATTGACCGTCGTACTGGCAAGGCTGTCGA
GGCTGCTCCCAAGTTCATCAAGTCGGGCGACTCTGCCATCGTCAAGATGGTCCCCTCCAAGCCCATGTGCGTCGA
GGCCTTCACTGACTACCCTCCGCTGGGTCGTTTCGCCGTCCGTGACATGCGTCAGACCGTCGCTGTCGGTGTCAT
CAAGTCGGTTGAGAAGACCAGCGGTGCCGCCGGTAAGGTGACTAAGTCTGCCGCCAAGGCTGCCAAGAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail