Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06209
Gene name
Locationscaffold_07:1598152..1599648
Strand+
Gene length (bp)1496
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-36 83 396

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 79 101 22
3 113 132 19
4 170 192 22
5 199 221 22
6 260 282 22
7 295 314 19
8 320 337 17
9 344 366 22
10 381 403 22
11 410 429 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 66.38 37.87 94.89
Alive In ants, during behavior modification 365.07 158.52 571.62
Dead In ants, recently dead 188.06 98.50 277.63

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.000238 yes
Alive Dead 0.000657 yes
Dead Fungus 0.000238 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06209
MAVVDRKKVLRVIIVSLLLDLISFTFILPLFPKLLEFYRDREAPALVQHGPQTLLQRVIAGLNSYKMAFSRPIDS
RHDIVLLGGAMGSLFSLLQAIASPVIGRLSDRYGRRAALLASMCGNILSVLLWLAAVDFRTFIASRVVGGLSEGN
IQLATAIASDISDDASRGSTMAIIGSCFCVAFTFGPALGAWLSTMAVMAANPFAMAAGFSLLLILVETVYLYFCL
PETLPALTQPGRRGREAVSEAKRRTTSVERTNSPWLLYAVNFFFLLFFSGMESSLSFMTYELFAFSPGKNGRLLG
FIGLVASVLQGGVTRRMPPLLSIRVGVVACLASFVLLGRINTVGGLYVAATCLATTSATVVTGLNALSSFDASED
ERGSKLGILRSWGQLGRGLGPVLFTSIYWWAGREYAYNVGATGILMVAAAAFMGLKTPKAASVSVKRA*
Coding >Ophcf2|06209
ATGGCAGTCGTCGATAGGAAAAAGGTCCTTCGGGTCATCATCGTCTCCCTCCTCCTTGATTTGATCTCCTTTACC
TTCATCCTACCGCTCTTCCCCAAGCTTCTCGAGTTCTATCGTGATCGCGAGGCCCCGGCCCTCGTCCAACATGGC
CCGCAGACGTTGCTTCAGCGCGTCATCGCCGGTCTCAACAGCTACAAGATGGCCTTTTCGCGGCCCATCGATTCG
CGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGCTCGCTCTTCTCCCTGCTGCAAGCCATAGCCTCGCCCGTC
ATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGTGGCAACATCCTCTCCGTT
CTGTTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGACTATCCGAGGGCAAT
ATCCAGCTTGCGACCGCCATCGCCAGCGACATTTCGGATGACGCCTCGCGCGGTTCCACAATGGCCATCATCGGC
TCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGGCCGTCATGGCTGCG
AACCCGTTCGCCATGGCCGCCGGCTTCAGCTTGTTGCTGATTCTTGTCGAGACCGTCTATCTCTACTTTTGCCTT
CCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGAGGCGGGGCCGTGAGGCCGTGTCTGAGGCGAAACGCCGGACG
ACGTCGGTGGAAAGGACCAACTCACCTTGGTTACTCTACGCTGTCAATTTTTTTTTCCTCCTCTTCTTCTCTGGA
ATGGAGAGTTCGCTCTCGTTTATGACCTACGAGCTTTTCGCCTTTTCGCCGGGCAAGAACGGCAGGTTGCTGGGT
TTCATAGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTCACGCGCAGGATGCCGCCTCTTCTGTCTATCCGTGTC
GGTGTCGTGGCCTGTCTTGCGTCCTTTGTCCTACTCGGGAGGATCAACACCGTGGGCGGTCTTTACGTTGCCGCC
ACCTGTCTTGCCACGACATCGGCTACCGTCGTCACTGGTCTCAATGCGCTGAGTAGTTTTGATGCCAGCGAGGAC
GAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGCCAGCTGGGACGTGGCCTCGGTCCCGTCTTGTTCACC
AGCATCTACTGGTGGGCGGGACGCGAGTATGCGTACAACGTGGGCGCGACGGGCATTCTCATGGTGGCAGCGGCT
GCTTTTATGGGACTCAAGACGCCCAAGGCGGCGAGCGTGAGCGTCAAGCGAGCATGA
Transcript >Ophcf2|06209
ATGGCAGTCGTCGATAGGAAAAAGGTCCTTCGGGTCATCATCGTCTCCCTCCTCCTTGATTTGATCTCCTTTACC
TTCATCCTACCGCTCTTCCCCAAGCTTCTCGAGTTCTATCGTGATCGCGAGGCCCCGGCCCTCGTCCAACATGGC
CCGCAGACGTTGCTTCAGCGCGTCATCGCCGGTCTCAACAGCTACAAGATGGCCTTTTCGCGGCCCATCGATTCG
CGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGCTCGCTCTTCTCCCTGCTGCAAGCCATAGCCTCGCCCGTC
ATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGTGGCAACATCCTCTCCGTT
CTGTTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGACTATCCGAGGGCAAT
ATCCAGCTTGCGACCGCCATCGCCAGCGACATTTCGGATGACGCCTCGCGCGGTTCCACAATGGCCATCATCGGC
TCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGGCCGTCATGGCTGCG
AACCCGTTCGCCATGGCCGCCGGCTTCAGCTTGTTGCTGATTCTTGTCGAGACCGTCTATCTCTACTTTTGCCTT
CCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGAGGCGGGGCCGTGAGGCCGTGTCTGAGGCGAAACGCCGGACG
ACGTCGGTGGAAAGGACCAACTCACCTTGGTTACTCTACGCTGTCAATTTTTTTTTCCTCCTCTTCTTCTCTGGA
ATGGAGAGTTCGCTCTCGTTTATGACCTACGAGCTTTTCGCCTTTTCGCCGGGCAAGAACGGCAGGTTGCTGGGT
TTCATAGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTCACGCGCAGGATGCCGCCTCTTCTGTCTATCCGTGTC
GGTGTCGTGGCCTGTCTTGCGTCCTTTGTCCTACTCGGGAGGATCAACACCGTGGGCGGTCTTTACGTTGCCGCC
ACCTGTCTTGCCACGACATCGGCTACCGTCGTCACTGGTCTCAATGCGCTGAGTAGTTTTGATGCCAGCGAGGAC
GAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGCCAGCTGGGACGTGGCCTCGGTCCCGTCTTGTTCACC
AGCATCTACTGGTGGGCGGGACGCGAGTATGCGTACAACGTGGGCGCGACGGGCATTCTCATGGTGGCAGCGGCT
GCTTTTATGGGACTCAAGACGCCCAAGGCGGCGAGCGTGAGCGTCAAGCGAGCATGA
Gene >Ophcf2|06209
ATGGCAGTCGTCGATAGGAAAAAGGTCCTTCGGGTCATCATCGTCTCCCTCCTCCTTGATTTGGTCGGTGGCTCC
CCGGGCGGATACGCGCCAAGCATCGAGACTCCGCTGACTCTCCACCGAAAAATGAAAAATAAAAAATAAAAACAC
GGGCAGATCTCCTTTACCTTCATCCTACCGCTCTTCCCCAAGCTTCTCGAGTTCTATCGTGATCGCGAGGCCCCG
GCCCTCGTCCAACATGGCCCGCAGACGTTGCTTCAGCGCGTCATCGCCGGTCTCAACAGCTACAAGATGGCCTTT
TCGCGGCCCATCGATTCGCGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGCTCGCTCTTCTCGTGCGCCACT
CTCATCATTCCATTCCCTTCCTCCGCCGTCTCGTTGACAATCGCCACCCCTTTCCCCACAGCCTGCTGCAAGCCA
TAGCCTCGCCCGTCATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGTGGCA
ACATCCTCTCCGTTCTGTTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGAC
TATCCGAGGGCAATATCCAGCTTGCGACCGCCATCGCCAGCGACATTTCGGATGACGCCTCGCGCGGTTCCACAA
TGGCCATCATCGGCTCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGG
CCGTCATGGCTGCGAACCCGTTCGCCATGGCCGCCGGCTTCAGCTTGTTGCTGATTCTTGTCGAGACCGTCTATC
TCTACTTTTGCCTTCCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGAGGCGGGGCCGTGAGGCCGTGTCTGAGG
CGAAACGCCGGACGACGTCGGTGGAAAGGACCAACTCACCTTGGTTACTCTACGCTGTCAATTTTTTTTTCCTCC
TCTTCTTCTCTGGAATGGAGAGTTCGCTCTCGTTTATGACCTACGAGCTTTTCGCCTTTTCGCCGGGCAAGAACG
GCAGGTTGCTGGGTTTCATAGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTCACGCGCAGGATGCCGCCTCTTC
TGTCTATCCGTGTCGGTGTCGTGGCCTGTCTTGCGTCCTTTGTCCTACTCGGGAGGATCAACACCGTGGGCGGTC
TTTACGTTGCCGCCACCTGTCTTGCCACGACATCGGCTACCGTCGTCACTGGTCTCAATGCGCTGAGTAGTTTTG
ATGCCAGCGAGGACGAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGCCAGCTGGGACGTGGCCTCGGTC
CCGTCTTGTTCACCAGCATCTACTGGTGGGCGGGACGCGAGTATGCGTACAACGTGGGCGCGACGGGCATTCTCA
TGGTGGCAGCGGCTGCTTTTATGGGACTCAAGACGCCCAAGGCGGCGAGCGTGAGCGTCAAGCGAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail