Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06209
Gene name
Locationscaffold_07:1598152..1599648
Strand+
Gene length (bp)1496
Transcript length (bp)1332
Coding sequence length (bp)1332
Protein length (aa) 444

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 5.0E-36 83 396

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 9 31 22
2 79 101 22
3 113 132 19
4 170 192 22
5 199 221 22
6 260 282 22
7 295 314 19
8 320 337 17
9 344 366 22
10 381 403 22
11 410 429 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06209
MAVVDRKKVLRVIIVSLLLDLISFTFILPLFPKLLEFYRDREAPALVQHGPQTLLQRVIAGLNSYKMAFSRPIDS
RHDIVLLGGAMGSLFSLLQAIASPVIGRLSDRYGRRAALLASMCGNILSVLLWLAAVDFRTFIASRVVGGLSEGN
IQLATAIASDISDDASRGSTMAIIGSCFCVAFTFGPALGAWLSTMAVMAANPFAMAAGFSLLLILVETVYLYFCL
PETLPALTQPGRRGREAVSEAKRRTTSVERTNSPWLLYAVNFFFLLFFSGMESSLSFMTYELFAFSPGKNGRLLG
FIGLVASVLQGGVTRRMPPLLSIRVGVVACLASFVLLGRINTVGGLYVAATCLATTSATVVTGLNALSSFDASED
ERGSKLGILRSWGQLGRGLGPVLFTSIYWWAGREYAYNVGATGILMVAAAAFMGLKTPKAASVSVKRA*
Coding >Ophcf2|06209
ATGGCAGTCGTCGATAGGAAAAAGGTCCTTCGGGTCATCATCGTCTCCCTCCTCCTTGATTTGATCTCCTTTACC
TTCATCCTACCGCTCTTCCCCAAGCTTCTCGAGTTCTATCGTGATCGCGAGGCCCCGGCCCTCGTCCAACATGGC
CCGCAGACGTTGCTTCAGCGCGTCATCGCCGGTCTCAACAGCTACAAGATGGCCTTTTCGCGGCCCATCGATTCG
CGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGCTCGCTCTTCTCCCTGCTGCAAGCCATAGCCTCGCCCGTC
ATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGTGGCAACATCCTCTCCGTT
CTGTTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGACTATCCGAGGGCAAT
ATCCAGCTTGCGACCGCCATCGCCAGCGACATTTCGGATGACGCCTCGCGCGGTTCCACAATGGCCATCATCGGC
TCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGGCCGTCATGGCTGCG
AACCCGTTCGCCATGGCCGCCGGCTTCAGCTTGTTGCTGATTCTTGTCGAGACCGTCTATCTCTACTTTTGCCTT
CCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGAGGCGGGGCCGTGAGGCCGTGTCTGAGGCGAAACGCCGGACG
ACGTCGGTGGAAAGGACCAACTCACCTTGGTTACTCTACGCTGTCAATTTTTTTTTCCTCCTCTTCTTCTCTGGA
ATGGAGAGTTCGCTCTCGTTTATGACCTACGAGCTTTTCGCCTTTTCGCCGGGCAAGAACGGCAGGTTGCTGGGT
TTCATAGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTCACGCGCAGGATGCCGCCTCTTCTGTCTATCCGTGTC
GGTGTCGTGGCCTGTCTTGCGTCCTTTGTCCTACTCGGGAGGATCAACACCGTGGGCGGTCTTTACGTTGCCGCC
ACCTGTCTTGCCACGACATCGGCTACCGTCGTCACTGGTCTCAATGCGCTGAGTAGTTTTGATGCCAGCGAGGAC
GAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGCCAGCTGGGACGTGGCCTCGGTCCCGTCTTGTTCACC
AGCATCTACTGGTGGGCGGGACGCGAGTATGCGTACAACGTGGGCGCGACGGGCATTCTCATGGTGGCAGCGGCT
GCTTTTATGGGACTCAAGACGCCCAAGGCGGCGAGCGTGAGCGTCAAGCGAGCATGA
Transcript >Ophcf2|06209
ATGGCAGTCGTCGATAGGAAAAAGGTCCTTCGGGTCATCATCGTCTCCCTCCTCCTTGATTTGATCTCCTTTACC
TTCATCCTACCGCTCTTCCCCAAGCTTCTCGAGTTCTATCGTGATCGCGAGGCCCCGGCCCTCGTCCAACATGGC
CCGCAGACGTTGCTTCAGCGCGTCATCGCCGGTCTCAACAGCTACAAGATGGCCTTTTCGCGGCCCATCGATTCG
CGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGCTCGCTCTTCTCCCTGCTGCAAGCCATAGCCTCGCCCGTC
ATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGTGGCAACATCCTCTCCGTT
CTGTTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGACTATCCGAGGGCAAT
ATCCAGCTTGCGACCGCCATCGCCAGCGACATTTCGGATGACGCCTCGCGCGGTTCCACAATGGCCATCATCGGC
TCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGGCCGTCATGGCTGCG
AACCCGTTCGCCATGGCCGCCGGCTTCAGCTTGTTGCTGATTCTTGTCGAGACCGTCTATCTCTACTTTTGCCTT
CCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGAGGCGGGGCCGTGAGGCCGTGTCTGAGGCGAAACGCCGGACG
ACGTCGGTGGAAAGGACCAACTCACCTTGGTTACTCTACGCTGTCAATTTTTTTTTCCTCCTCTTCTTCTCTGGA
ATGGAGAGTTCGCTCTCGTTTATGACCTACGAGCTTTTCGCCTTTTCGCCGGGCAAGAACGGCAGGTTGCTGGGT
TTCATAGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTCACGCGCAGGATGCCGCCTCTTCTGTCTATCCGTGTC
GGTGTCGTGGCCTGTCTTGCGTCCTTTGTCCTACTCGGGAGGATCAACACCGTGGGCGGTCTTTACGTTGCCGCC
ACCTGTCTTGCCACGACATCGGCTACCGTCGTCACTGGTCTCAATGCGCTGAGTAGTTTTGATGCCAGCGAGGAC
GAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGCCAGCTGGGACGTGGCCTCGGTCCCGTCTTGTTCACC
AGCATCTACTGGTGGGCGGGACGCGAGTATGCGTACAACGTGGGCGCGACGGGCATTCTCATGGTGGCAGCGGCT
GCTTTTATGGGACTCAAGACGCCCAAGGCGGCGAGCGTGAGCGTCAAGCGAGCATGA
Gene >Ophcf2|06209
ATGGCAGTCGTCGATAGGAAAAAGGTCCTTCGGGTCATCATCGTCTCCCTCCTCCTTGATTTGGTCGGTGGCTCC
CCGGGCGGATACGCGCCAAGCATCGAGACTCCGCTGACTCTCCACCGAAAAATGAAAAATAAAAAATAAAAACAC
GGGCAGATCTCCTTTACCTTCATCCTACCGCTCTTCCCCAAGCTTCTCGAGTTCTATCGTGATCGCGAGGCCCCG
GCCCTCGTCCAACATGGCCCGCAGACGTTGCTTCAGCGCGTCATCGCCGGTCTCAACAGCTACAAGATGGCCTTT
TCGCGGCCCATCGATTCGCGCCATGACATCGTCCTTCTGGGCGGAGCCATGGGCTCGCTCTTCTCGTGCGCCACT
CTCATCATTCCATTCCCTTCCTCCGCCGTCTCGTTGACAATCGCCACCCCTTTCCCCACAGCCTGCTGCAAGCCA
TAGCCTCGCCCGTCATCGGCCGCTTGTCCGACCGATATGGCCGCCGCGCCGCCCTGCTCGCTTCCATGTGTGGCA
ACATCCTCTCCGTTCTGTTGTGGCTTGCCGCCGTCGACTTCCGCACCTTTATCGCCAGCCGCGTCGTCGGCGGAC
TATCCGAGGGCAATATCCAGCTTGCGACCGCCATCGCCAGCGACATTTCGGATGACGCCTCGCGCGGTTCCACAA
TGGCCATCATCGGCTCTTGTTTCTGCGTCGCTTTTACCTTTGGTCCGGCTCTCGGCGCTTGGCTTAGCACCATGG
CCGTCATGGCTGCGAACCCGTTCGCCATGGCCGCCGGCTTCAGCTTGTTGCTGATTCTTGTCGAGACCGTCTATC
TCTACTTTTGCCTTCCCGAGACGCTTCCCGCTTTGACGCAGCCCGGGAGGCGGGGCCGTGAGGCCGTGTCTGAGG
CGAAACGCCGGACGACGTCGGTGGAAAGGACCAACTCACCTTGGTTACTCTACGCTGTCAATTTTTTTTTCCTCC
TCTTCTTCTCTGGAATGGAGAGTTCGCTCTCGTTTATGACCTACGAGCTTTTCGCCTTTTCGCCGGGCAAGAACG
GCAGGTTGCTGGGTTTCATAGGTCTCGTGGCGTCGGTTCTTCAGGGCGGCGTCACGCGCAGGATGCCGCCTCTTC
TGTCTATCCGTGTCGGTGTCGTGGCCTGTCTTGCGTCCTTTGTCCTACTCGGGAGGATCAACACCGTGGGCGGTC
TTTACGTTGCCGCCACCTGTCTTGCCACGACATCGGCTACCGTCGTCACTGGTCTCAATGCGCTGAGTAGTTTTG
ATGCCAGCGAGGACGAGCGAGGGAGCAAGCTGGGCATCCTGCGCAGCTGGGGCCAGCTGGGACGTGGCCTCGGTC
CCGTCTTGTTCACCAGCATCTACTGGTGGGCGGGACGCGAGTATGCGTACAACGTGGGCGCGACGGGCATTCTCA
TGGTGGCAGCGGCTGCTTTTATGGGACTCAAGACGCCCAAGGCGGCGAGCGTGAGCGTCAAGCGAGCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail