Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06208
Gene name
Locationscaffold_07:1593645..1595206
Strand+
Gene length (bp)1561
Transcript length (bp)1497
Coding sequence length (bp)1497
Protein length (aa) 499

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00171 Aldedh Aldehyde dehydrogenase family 4.1E-152 23 489

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7277 0.328 0.1041 0.0174 0.267 0.0139 0.0343 0.1922 0.0825 0.1002

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup103
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1562
Ophiocordyceps australis 1348a (Ghana) OphauG2|5602
Ophiocordyceps australis 1348a (Ghana) OphauG2|7818
Ophiocordyceps australis map64 (Brazil) OphauB2|3152
Ophiocordyceps australis map64 (Brazil) OphauB2|7406
Ophiocordyceps camponoti-floridani Ophcf2|02289
Ophiocordyceps camponoti-floridani Ophcf2|06208 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2751
Ophiocordyceps camponoti-rufipedis Ophun1|3762
Ophiocordyceps kimflemingae Ophio5|2786
Ophiocordyceps kimflemingae Ophio5|6168
Ophiocordyceps subramaniannii Hirsu2|4406
Ophiocordyceps subramaniannii Hirsu2|4545
Ophiocordyceps subramaniannii Hirsu2|4953

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06208
MSLPFKLNDSSLLHFECLIDGKWTAAKSGQRFTLVDPGSGSSWGECASAGRPEVETAVKAAHKAFEGYRAWTPRQ
RAQGLQRWYGLVEAAREDLATLLVYETGKPLEQARGEVDYALPFVDWAAGEAERIHGNWQRPSSGPGRRALTIKQ
PVGVSAALVPWNFPVVLALRKMAAALAAGCSCVLKPSPESPISALAVAKLVLDAGFPSGLVNVLPTSLEDTPIVA
EDLCSHPLVQVVSFTGSTRVGRIVAGWCAQNLKRSTLELGGNSPFIIFDDADLDKAVDQLTGLKWRHAGQACISA
NRVYVQRGIHDRLVEAIVARASRLSVGHGTKDGVTMGALTSDRGLERAEALAKDAREKGAKFVLGSGKRLDGGGG
GYFMEPTIVTGVTPDMEMSRDECFAPLLGVAAFDSEDEVVALANDTSMGLASYVFTQDADKLFRMFEKLDAGMVG
LNTGNSSSTETPFGGIKASGWGKEGGMGLGLEEYLWTKTGTMTVEGHW*
Coding >Ophcf2|06208
ATGTCTCTCCCGTTCAAACTCAACGACAGCAGTCTCCTCCATTTCGAATGTCTGATCGACGGCAAATGGACAGCG
GCCAAGTCGGGCCAGCGCTTCACCCTCGTCGACCCGGGCTCGGGCTCCAGCTGGGGCGAGTGCGCATCGGCGGGA
CGCCCCGAGGTTGAGACGGCCGTCAAGGCGGCGCACAAGGCCTTTGAAGGCTACCGCGCCTGGACACCGAGGCAG
AGGGCGCAGGGCCTGCAGCGATGGTACGGGCTGGTGGAGGCGGCGCGCGAGGACCTGGCCACCTTGTTGGTGTAT
GAGACGGGCAAGCCGCTGGAACAAGCTCGAGGTGAGGTCGACTATGCGCTTCCCTTTGTCGACTGGGCCGCGGGC
GAGGCCGAGCGAATCCACGGGAACTGGCAGCGGCCGTCGTCGGGACCGGGCCGGAGGGCGTTGACCATCAAGCAG
CCCGTCGGCGTGTCGGCCGCTCTGGTGCCCTGGAACTTCCCCGTCGTTCTGGCGCTCCGAAAGATGGCGGCGGCG
CTGGCTGCAGGCTGCTCTTGCGTGCTGAAGCCGTCGCCCGAGTCGCCCATCTCGGCCCTGGCCGTGGCCAAGCTC
GTTCTCGACGCCGGCTTCCCGTCCGGGCTGGTCAACGTGCTGCCGACGAGCCTCGAGGATACACCCATCGTGGCC
GAGGATCTCTGCAGTCATCCGCTGGTGCAGGTCGTCTCCTTCACCGGCAGCACCCGCGTCGGACGCATCGTGGCT
GGATGGTGCGCTCAGAACCTCAAGCGGTCGACTCTCGAGCTCGGAGGCAACTCACCCTTCATCATCTTTGACGAC
GCAGACCTCGACAAGGCCGTCGATCAGCTCACCGGTCTCAAGTGGCGCCATGCCGGCCAGGCCTGTATCTCGGCC
AACCGTGTCTACGTCCAGCGCGGTATTCATGACCGGCTCGTCGAGGCCATCGTTGCCCGGGCCTCCCGCCTGTCC
GTCGGCCACGGAACCAAGGACGGCGTCACCATGGGAGCCCTGACGTCGGACCGCGGGCTGGAAAGGGCCGAGGCT
CTGGCCAAGGACGCGCGGGAAAAGGGCGCCAAGTTCGTCCTCGGCTCGGGCAAGCGTCTGGACGGCGGCGGTGGC
GGCTACTTTATGGAACCGACCATCGTTACGGGCGTGACTCCCGACATGGAGATGAGTCGTGACGAGTGCTTTGCG
CCGTTGCTGGGCGTGGCGGCCTTTGATAGCGAGGACGAGGTGGTGGCCCTCGCCAACGATACCAGCATGGGACTG
GCCAGCTACGTTTTCACTCAAGACGCTGACAAACTCTTCCGGATGTTTGAGAAGCTTGACGCGGGCATGGTCGGA
CTGAACACGGGCAACTCATCATCGACCGAGACGCCCTTTGGCGGCATCAAGGCCAGTGGCTGGGGCAAGGAGGGC
GGAATGGGCCTAGGCCTCGAAGAATATCTCTGGACAAAGACGGGCACCATGACGGTAGAGGGCCATTGGTGA
Transcript >Ophcf2|06208
ATGTCTCTCCCGTTCAAACTCAACGACAGCAGTCTCCTCCATTTCGAATGTCTGATCGACGGCAAATGGACAGCG
GCCAAGTCGGGCCAGCGCTTCACCCTCGTCGACCCGGGCTCGGGCTCCAGCTGGGGCGAGTGCGCATCGGCGGGA
CGCCCCGAGGTTGAGACGGCCGTCAAGGCGGCGCACAAGGCCTTTGAAGGCTACCGCGCCTGGACACCGAGGCAG
AGGGCGCAGGGCCTGCAGCGATGGTACGGGCTGGTGGAGGCGGCGCGCGAGGACCTGGCCACCTTGTTGGTGTAT
GAGACGGGCAAGCCGCTGGAACAAGCTCGAGGTGAGGTCGACTATGCGCTTCCCTTTGTCGACTGGGCCGCGGGC
GAGGCCGAGCGAATCCACGGGAACTGGCAGCGGCCGTCGTCGGGACCGGGCCGGAGGGCGTTGACCATCAAGCAG
CCCGTCGGCGTGTCGGCCGCTCTGGTGCCCTGGAACTTCCCCGTCGTTCTGGCGCTCCGAAAGATGGCGGCGGCG
CTGGCTGCAGGCTGCTCTTGCGTGCTGAAGCCGTCGCCCGAGTCGCCCATCTCGGCCCTGGCCGTGGCCAAGCTC
GTTCTCGACGCCGGCTTCCCGTCCGGGCTGGTCAACGTGCTGCCGACGAGCCTCGAGGATACACCCATCGTGGCC
GAGGATCTCTGCAGTCATCCGCTGGTGCAGGTCGTCTCCTTCACCGGCAGCACCCGCGTCGGACGCATCGTGGCT
GGATGGTGCGCTCAGAACCTCAAGCGGTCGACTCTCGAGCTCGGAGGCAACTCACCCTTCATCATCTTTGACGAC
GCAGACCTCGACAAGGCCGTCGATCAGCTCACCGGTCTCAAGTGGCGCCATGCCGGCCAGGCCTGTATCTCGGCC
AACCGTGTCTACGTCCAGCGCGGTATTCATGACCGGCTCGTCGAGGCCATCGTTGCCCGGGCCTCCCGCCTGTCC
GTCGGCCACGGAACCAAGGACGGCGTCACCATGGGAGCCCTGACGTCGGACCGCGGGCTGGAAAGGGCCGAGGCT
CTGGCCAAGGACGCGCGGGAAAAGGGCGCCAAGTTCGTCCTCGGCTCGGGCAAGCGTCTGGACGGCGGCGGTGGC
GGCTACTTTATGGAACCGACCATCGTTACGGGCGTGACTCCCGACATGGAGATGAGTCGTGACGAGTGCTTTGCG
CCGTTGCTGGGCGTGGCGGCCTTTGATAGCGAGGACGAGGTGGTGGCCCTCGCCAACGATACCAGCATGGGACTG
GCCAGCTACGTTTTCACTCAAGACGCTGACAAACTCTTCCGGATGTTTGAGAAGCTTGACGCGGGCATGGTCGGA
CTGAACACGGGCAACTCATCATCGACCGAGACGCCCTTTGGCGGCATCAAGGCCAGTGGCTGGGGCAAGGAGGGC
GGAATGGGCCTAGGCCTCGAAGAATATCTCTGGACAAAGACGGGCACCATGACGGTAGAGGGCCATTGGTGA
Gene >Ophcf2|06208
ATGTCTCTCCCGTTCAAACTCAACGACAGCAGTCTCCTCCATTTCGAATGTCTGATCGACGGCAAATGGACAGCG
GCCAAGTCGGGCCAGCGCTTCACCCTCGTCGACCCGGGCTCGGGCTCCAGCTGGGGCGAGTGCGCATCGGCGGGA
CGCCCCGAGGTTGAGACGGCCGTCAAGGCGGCGCACAAGGCCTTTGAAGGCTACCGCGCCTGGACACCGAGGCAG
AGGGCGCAGGGCCTGCAGCGATGGTACGGGCTGGTGGAGGCGGCGCGCGAGGACCTGGCCACCTTGTTGGTGTAT
GAGACGGGCAAGCCGCTGGAACAAGCTCGAGGTGAGGTCGACTATGCGCTTCCCTTTGTCGACTGGGCCGCGGGC
GAGGCCGAGCGAATCCACGGGAACTGGCAGCGGCCGTCGTCGGGACCGGGCCGGAGGGCGTTGACCATCAAGCAG
CCCGTCGGCGTGTCGGCCGCTCTGGTGCCCTGGAACTTCCCCGTCGTTCTGGCGCTCCGAAAGATGGCGGCGGCG
CTGGCTGCAGGCTGCTCTTGCGTGCTGAAGCCGTCGCCCGAGTCGCCCATCTCGGCCCTGGCCGTGGCCAAGCTC
GTTCTCGACGCCGGCTTCCCGTCCGGGCTGGTCAACGTGCTGCCGACGAGCCTCGAGGATACACCCATCGTGGCC
GAGGATCTCTGCAGTCATCCGCTGGTGCAGGTCGTCTCCTTCACCGGCAGCACCCGCGTCGGACGCATCGTGGCT
GGATGGTGCGCTCAGAACCTCAAGCGGTCGACTCTCGAGCTCGGAGGCAACTCACCCTTCATCATCTTTGACGAC
GCAGACCTCGACAAGGCCGTCGATCAGCTCACCGGTCTCAAGTGGCGCCATGCCGGCCAGGCCTGTATCTCGGCC
AACCGTGTCTACGTCCAGCGCGGTATTCATGACCGGCTCGTCGAGGCCATCGTTGCCCGGGCCTCCCGCCTGTCC
GTCGGCCACGGAACCAAGGACGGCGTCACCATGGGAGCCCTGACGTCGGACCGCGGGCTGGAAAGGGCCGAGGCT
CTGGCCAAGGACGCGCGGGAAAAGGGCGCCAAGTTCGTCCTCGGCTCGGGCAAGCGTCTGGACGGCGGCGGTGGC
GGCTACTTTATGGAACCGACCATCGTTACGGGCGTGACTCCCGACATGGAGATGAGTCGTGACGAGTGCTTTGCG
CCGTTGCTGGGCGTGGCGGCCTTTGATAGCGAGGACGAGGTGGTGGCCCTCGCCAACGATACCAGCATGGGACTG
GCCAGCTACGTTTTCACTCAAGACGCTGACAAACTCTTCCGGATGTTTGAGAAGCTTGACGCGGGCATGGTCGGA
CTGGTGCGTACTCGTTGTTCCACTTTGCCCTTTCCCCTTGACCTCGCTGACACGGAGACGGACCCAGAACACGGG
CAACTCATCATCGACCGAGACGCCCTTTGGCGGCATCAAGGCCAGTGGCTGGGGCAAGGAGGGCGGAATGGGCCT
AGGCCTCGAAGAATATCTCTGGACAAAGACGGGCACCATGACGGTAGAGGGCCATTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail