Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06206
Gene name
Locationscaffold_07:1590919..1591477
Strand-
Gene length (bp)558
Transcript length (bp)558
Coding sequence length (bp)558
Protein length (aa) 186

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09811 Yae1_N Essential protein Yae1, N terminal 4.1E-08 39 77

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.6988 0.7854 0.0145 0.0389 0.1362 0.0038 0.0427 0.0297 0.09 0.3611

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5489
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|716
Ophiocordyceps australis map64 (Brazil) OphauB2|7409
Ophiocordyceps camponoti-floridani Ophcf2|06206 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2753
Ophiocordyceps kimflemingae Ophio5|7779
Ophiocordyceps subramaniannii Hirsu2|6521

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06206
MAQETGSETEAASLDDVFCAEASHPSDVRRLQTEHAAAGYREAISTAKQTTIQAGFDDGFRLGAALGLRAGRILG
LLEGICEAVPDEVEAEKLLATAREELSVSSLLSSSYWAPDGERKFQTGSDGDNFANSHPLIDKWNSLVDRQLARW
AIDEAVLGGEPGRSLADEAIISSSAPLGPSQPLEW*
Coding >Ophcf2|06206
ATGGCGCAAGAAACCGGCTCCGAAACAGAGGCTGCCTCCCTGGATGATGTCTTTTGCGCCGAAGCCAGCCATCCG
TCCGATGTAAGGCGGCTGCAGACCGAACACGCGGCGGCTGGCTATCGTGAGGCCATCTCGACCGCCAAGCAGACG
ACCATCCAGGCGGGCTTCGACGACGGCTTCCGTCTGGGCGCTGCTCTGGGACTGCGGGCCGGTAGAATCCTTGGT
CTGCTCGAGGGCATCTGTGAAGCCGTCCCGGACGAAGTCGAAGCCGAGAAGCTGCTGGCAACGGCGCGGGAGGAG
CTCAGCGTGTCGAGCCTCCTATCCTCATCATACTGGGCGCCAGATGGTGAGCGCAAGTTCCAAACGGGCTCCGAC
GGCGACAACTTTGCCAATAGCCACCCGTTAATCGATAAGTGGAACAGCCTTGTCGATCGGCAGCTTGCGAGATGG
GCCATAGACGAAGCCGTCTTGGGAGGCGAACCGGGCCGATCACTAGCCGACGAAGCGATCATCTCCTCGTCAGCC
CCTTTGGGACCGAGTCAGCCCCTGGAGTGGTGA
Transcript >Ophcf2|06206
ATGGCGCAAGAAACCGGCTCCGAAACAGAGGCTGCCTCCCTGGATGATGTCTTTTGCGCCGAAGCCAGCCATCCG
TCCGATGTAAGGCGGCTGCAGACCGAACACGCGGCGGCTGGCTATCGTGAGGCCATCTCGACCGCCAAGCAGACG
ACCATCCAGGCGGGCTTCGACGACGGCTTCCGTCTGGGCGCTGCTCTGGGACTGCGGGCCGGTAGAATCCTTGGT
CTGCTCGAGGGCATCTGTGAAGCCGTCCCGGACGAAGTCGAAGCCGAGAAGCTGCTGGCAACGGCGCGGGAGGAG
CTCAGCGTGTCGAGCCTCCTATCCTCATCATACTGGGCGCCAGATGGTGAGCGCAAGTTCCAAACGGGCTCCGAC
GGCGACAACTTTGCCAATAGCCACCCGTTAATCGATAAGTGGAACAGCCTTGTCGATCGGCAGCTTGCGAGATGG
GCCATAGACGAAGCCGTCTTGGGAGGCGAACCGGGCCGATCACTAGCCGACGAAGCGATCATCTCCTCGTCAGCC
CCTTTGGGACCGAGTCAGCCCCTGGAGTGGTGA
Gene >Ophcf2|06206
ATGGCGCAAGAAACCGGCTCCGAAACAGAGGCTGCCTCCCTGGATGATGTCTTTTGCGCCGAAGCCAGCCATCCG
TCCGATGTAAGGCGGCTGCAGACCGAACACGCGGCGGCTGGCTATCGTGAGGCCATCTCGACCGCCAAGCAGACG
ACCATCCAGGCGGGCTTCGACGACGGCTTCCGTCTGGGCGCTGCTCTGGGACTGCGGGCCGGTAGAATCCTTGGT
CTGCTCGAGGGCATCTGTGAAGCCGTCCCGGACGAAGTCGAAGCCGAGAAGCTGCTGGCAACGGCGCGGGAGGAG
CTCAGCGTGTCGAGCCTCCTATCCTCATCATACTGGGCGCCAGATGGTGAGCGCAAGTTCCAAACGGGCTCCGAC
GGCGACAACTTTGCCAATAGCCACCCGTTAATCGATAAGTGGAACAGCCTTGTCGATCGGCAGCTTGCGAGATGG
GCCATAGACGAAGCCGTCTTGGGAGGCGAACCGGGCCGATCACTAGCCGACGAAGCGATCATCTCCTCGTCAGCC
CCTTTGGGACCGAGTCAGCCCCTGGAGTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail