Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06203
Gene name
Locationscaffold_07:1585545..1587258
Strand-
Gene length (bp)1713
Transcript length (bp)1647
Coding sequence length (bp)1647
Protein length (aa) 549

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13000 Acatn Acetyl-coenzyme A transporter 1 1.3E-81 80 289
PF13000 Acatn Acetyl-coenzyme A transporter 1 8.7E-26 291 373
PF13000 Acatn Acetyl-coenzyme A transporter 1 3.3E-53 377 545

GO

GO Term Description Terminal node
GO:0008521 acetyl-CoA transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0005215 transporter activity No
GO:0005346 purine ribonucleotide transmembrane transporter activity No
GO:1901682 sulfur compound transmembrane transporter activity No
GO:0110165 cellular anatomical entity No
GO:0071077 adenosine 3',5'-bisphosphate transmembrane transporter activity No
GO:1901505 carbohydrate derivative transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0031224 intrinsic component of membrane No
GO:0015215 nucleotide transmembrane transporter activity No
GO:0008509 anion transmembrane transporter activity No
GO:0000295 adenine nucleotide transmembrane transporter activity No
GO:0008514 organic anion transmembrane transporter activity No
GO:0015216 purine nucleotide transmembrane transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0015075 ion transmembrane transporter activity No
GO:0015932 nucleobase-containing compound transmembrane transporter activity No
GO:0015605 organophosphate ester transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 80 102 22
2 112 134 22
3 147 164 17
4 174 196 22
5 225 247 22
6 262 284 22
7 346 368 22
8 378 400 22
9 407 429 22
10 444 466 22
11 510 529 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06203
MSARARRRPSSQNLAEKNANGTMQNGFEMRRKGGSPTKTGADSIMSRSDFSLDGPVPAVSRGGDSSRGFLELPRQ
DQRNFLLLVLLYFLQGIPMGLAMGSVPFLLKNHLSYGEIGTFSLASYPYSLKLLWSPFVDAVWSRRMGRRKTWIV
PIQFLSGLGMLWLGSRVENMMSTMGQAGGPTVWGFMLWWFFLVLMCATQDIAVDGWALTLLSPANVSYASTAQTV
GLTAGHFLSFTVFLALNASDLANRWLRTVPSEAGLVSLGGYLRLWGWAYIVVTIGLALLKREERSRNDDGVWDVY
RTMWGILKLRNVQAMIVVHLIAKLGFQANDGVTNLKLLDKGFGKDNMALTVLIDFPFEIGLGYYAGMWSQRYTPM
RLWCWGFMGRLAAAVVAQMTVMVFPAEGVTTWYLLLVIGEHVLSTFTNTVMFVAVSAFHAKVSDPVIGGTYMTLL
ATVSNLGGTFPRYFVLRLVDALTVATCRGGPDDGQSCAVQAAKERCERARGRCEVLQDGYHAVNVLCVAFGVVTF
FWYIRPKVMHLQALPLRAWRLAR*
Coding >Ophcf2|06203
ATGAGTGCTCGAGCCAGACGGCGGCCGTCCAGTCAGAACTTGGCGGAGAAGAATGCCAACGGCACGATGCAAAAT
GGCTTCGAGATGAGGCGCAAGGGCGGAAGCCCCACCAAGACGGGCGCCGACAGCATCATGTCGCGATCCGACTTT
TCCCTCGATGGGCCGGTGCCGGCCGTCAGTCGCGGCGGTGACAGTAGCCGCGGGTTTCTGGAGCTGCCGCGACAG
GACCAGCGCAACTTTTTGTTGCTGGTGCTGCTCTACTTCTTACAGGGCATCCCGATGGGGCTGGCCATGGGGTCG
GTGCCTTTTCTGCTCAAGAACCACCTCTCATACGGCGAGATCGGGACGTTTAGCCTGGCGTCTTATCCCTACTCG
CTCAAGCTGCTATGGAGCCCGTTTGTCGACGCCGTGTGGAGTCGACGGATGGGGCGGCGCAAGACGTGGATCGTG
CCGATTCAGTTCCTGTCGGGCCTCGGCATGCTCTGGCTCGGGTCGCGGGTCGAGAACATGATGTCGACCATGGGC
CAGGCTGGAGGGCCGACGGTTTGGGGGTTCATGCTGTGGTGGTTCTTCCTGGTACTGATGTGCGCGACGCAGGAC
ATTGCCGTCGATGGCTGGGCGCTGACGCTGCTGTCGCCGGCCAACGTGTCTTATGCGTCGACGGCGCAGACGGTT
GGACTGACGGCCGGACACTTTCTCTCCTTTACCGTGTTTCTGGCTCTCAACGCGAGCGATCTCGCCAACCGGTGG
CTGCGGACGGTGCCGTCGGAGGCCGGGCTCGTCTCGCTGGGCGGCTACCTTCGGCTCTGGGGCTGGGCATACATC
GTGGTGACGATAGGACTGGCGCTCTTGAAGCGCGAGGAGCGGTCTCGCAACGACGACGGCGTGTGGGACGTCTAC
CGCACCATGTGGGGGATCCTCAAGCTGCGCAACGTGCAGGCCATGATTGTGGTGCACCTCATCGCCAAGCTGGGC
TTCCAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAAGACAACATGGCGCTGACG
GTGCTCATCGACTTTCCCTTTGAGATTGGACTCGGCTACTATGCCGGCATGTGGTCGCAACGATACACGCCCATG
AGGCTGTGGTGTTGGGGATTCATGGGCCGGCTGGCGGCGGCCGTGGTGGCGCAGATGACGGTCATGGTGTTTCCG
GCCGAGGGCGTGACGACGTGGTATCTGCTTCTGGTGATTGGGGAGCACGTGCTGTCGACGTTTACCAACACGGTC
ATGTTTGTGGCCGTGTCAGCCTTTCACGCCAAGGTGTCAGATCCGGTGATTGGGGGCACGTACATGACGCTGCTG
GCGACCGTATCCAACCTGGGCGGCACATTCCCTCGCTACTTCGTGCTGAGGCTCGTCGACGCGCTGACGGTAGCG
ACATGCCGCGGAGGCCCGGACGACGGCCAGTCTTGCGCAGTTCAGGCGGCCAAGGAGCGGTGCGAGAGGGCTCGA
GGCCGGTGCGAAGTTTTGCAGGACGGATATCATGCCGTCAACGTGCTGTGCGTGGCCTTTGGCGTCGTCACCTTT
TTCTGGTACATCCGGCCCAAGGTGATGCATCTGCAGGCGCTGCCGCTACGGGCCTGGCGGTTGGCGAGGTGA
Transcript >Ophcf2|06203
ATGAGTGCTCGAGCCAGACGGCGGCCGTCCAGTCAGAACTTGGCGGAGAAGAATGCCAACGGCACGATGCAAAAT
GGCTTCGAGATGAGGCGCAAGGGCGGAAGCCCCACCAAGACGGGCGCCGACAGCATCATGTCGCGATCCGACTTT
TCCCTCGATGGGCCGGTGCCGGCCGTCAGTCGCGGCGGTGACAGTAGCCGCGGGTTTCTGGAGCTGCCGCGACAG
GACCAGCGCAACTTTTTGTTGCTGGTGCTGCTCTACTTCTTACAGGGCATCCCGATGGGGCTGGCCATGGGGTCG
GTGCCTTTTCTGCTCAAGAACCACCTCTCATACGGCGAGATCGGGACGTTTAGCCTGGCGTCTTATCCCTACTCG
CTCAAGCTGCTATGGAGCCCGTTTGTCGACGCCGTGTGGAGTCGACGGATGGGGCGGCGCAAGACGTGGATCGTG
CCGATTCAGTTCCTGTCGGGCCTCGGCATGCTCTGGCTCGGGTCGCGGGTCGAGAACATGATGTCGACCATGGGC
CAGGCTGGAGGGCCGACGGTTTGGGGGTTCATGCTGTGGTGGTTCTTCCTGGTACTGATGTGCGCGACGCAGGAC
ATTGCCGTCGATGGCTGGGCGCTGACGCTGCTGTCGCCGGCCAACGTGTCTTATGCGTCGACGGCGCAGACGGTT
GGACTGACGGCCGGACACTTTCTCTCCTTTACCGTGTTTCTGGCTCTCAACGCGAGCGATCTCGCCAACCGGTGG
CTGCGGACGGTGCCGTCGGAGGCCGGGCTCGTCTCGCTGGGCGGCTACCTTCGGCTCTGGGGCTGGGCATACATC
GTGGTGACGATAGGACTGGCGCTCTTGAAGCGCGAGGAGCGGTCTCGCAACGACGACGGCGTGTGGGACGTCTAC
CGCACCATGTGGGGGATCCTCAAGCTGCGCAACGTGCAGGCCATGATTGTGGTGCACCTCATCGCCAAGCTGGGC
TTCCAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAAGACAACATGGCGCTGACG
GTGCTCATCGACTTTCCCTTTGAGATTGGACTCGGCTACTATGCCGGCATGTGGTCGCAACGATACACGCCCATG
AGGCTGTGGTGTTGGGGATTCATGGGCCGGCTGGCGGCGGCCGTGGTGGCGCAGATGACGGTCATGGTGTTTCCG
GCCGAGGGCGTGACGACGTGGTATCTGCTTCTGGTGATTGGGGAGCACGTGCTGTCGACGTTTACCAACACGGTC
ATGTTTGTGGCCGTGTCAGCCTTTCACGCCAAGGTGTCAGATCCGGTGATTGGGGGCACGTACATGACGCTGCTG
GCGACCGTATCCAACCTGGGCGGCACATTCCCTCGCTACTTCGTGCTGAGGCTCGTCGACGCGCTGACGGTAGCG
ACATGCCGCGGAGGCCCGGACGACGGCCAGTCTTGCGCAGTTCAGGCGGCCAAGGAGCGGTGCGAGAGGGCTCGA
GGCCGGTGCGAAGTTTTGCAGGACGGATATCATGCCGTCAACGTGCTGTGCGTGGCCTTTGGCGTCGTCACCTTT
TTCTGGTACATCCGGCCCAAGGTGATGCATCTGCAGGCGCTGCCGCTACGGGCCTGGCGGTTGGCGAGGTGA
Gene >Ophcf2|06203
ATGAGTGCTCGAGCCAGACGGCGGCCGTCCAGTCAGAACTTGGCGGAGAAGAATGCCAACGGCACGATGCAAAAT
GGCTTCGAGATGAGGCGCAAGGGCGGAAGCCCCACCAAGACGGGCGCCGACAGCATCATGTCGCGATCCGACTTT
TCCCTCGATGGGCCGGTGCCGGCCGTCAGTCGCGGCGGTGACAGTAGCCGCGGGTTTCTGGAGCTGCCGCGACAG
GACCAGCGCAACTTTTTGTTGCTGGTGCTGCTCTACTTCTTACAGGGCATCCCGATGGGGCTGGCCATGGGGTCG
GTGCCTTTTCTGCTCAAGAACCACCTCTCATACGGCGAGATCGGGACGTTTAGCCTGGCGTCTTATCCCTACTCG
CTCAAGCTGCTATGGAGCCCGTTTGTCGACGCCGTGTGGAGTCGACGGATGGGGCGGCGCAAGACGTGGATCGTG
CCGATTCAGTTCCTGTCGGGCCTCGGCATGCTCTGGCTCGGGTCGCGGGTCGAGAACATGATGTCGACCATGGGC
CAGGCTGGAGGGCCGACGGTTTGGGGGTTCATGCTGTGGTGGTTCTTCCTGGTACTGATGTGCGCGACGCAGGAC
ATTGCCGTCGATGGCTGGGCGCTGACGCTGCTGTCGCCGGCCAACGTGTCTTATGCGTCGACGGCGCAGACGGTT
GGACTGACGGCCGGACACTTTCTCTCCTTTACCGTGTTTCTGGCTCTCAACGCGAGCGATCTCGCCAACCGGTGG
CTGCGGACGGTGCCGTCGGAGGCCGGGCTCGTCTCGCTGGGCGGCTACCTTCGGCTCTGGGGCTGGGCATACATC
GTGGTGACGATAGGACTGGCGCTCTTGAAGCGCGAGGAGCGGTCTCGCAACGACGACGGCGTGTGGGACGTCTAC
CGCACCATGTGGGGGATCCTCAAGCTGCGCAACGTGCAGGCCATGATTGTGGTGCACCTCATCGCCAAGCTGGGC
TTCCAGGCCAACGACGGCGTCACCAACCTCAAGCTGCTGGACAAGGGCTTCGGCAAAGACAACATGGCGCTGACG
GTGCTCATCGACTTTCCCTTTGAGATTGGACTCGGCTACTATGCCGGCATGTGGTCGCAACGATACACGCCCATG
AGGCTGTGGTGTTGGGGATTCATGGGCCGGCTGGCGGCGGCCGTGGTGGCGCAGATGACGGTCATGGTGTTTCCG
GCCGAGGGCGTGACGACGTGGTATCTGCTTCTGGTGATTGGGGAGCACGTGCTGTCGACGTTTACCAACACGGTC
ATGTTTGTGGCCGTGTCAGCCTTTCACGCCAAGGTGTCAGATCCGGTGATTGGGGGCACGTACATGACGCTGCTG
GCGACGTGAGTCGAAGATACTCCCCTCTCTCTTCTCACCTTGATGCTTCATTGCTGACCGAAGGCAAACAGCGTA
TCCAACCTGGGCGGCACATTCCCTCGCTACTTCGTGCTGAGGCTCGTCGACGCGCTGACGGTAGCGACATGCCGC
GGAGGCCCGGACGACGGCCAGTCTTGCGCAGTTCAGGCGGCCAAGGAGCGGTGCGAGAGGGCTCGAGGCCGGTGC
GAAGTTTTGCAGGACGGATATCATGCCGTCAACGTGCTGTGCGTGGCCTTTGGCGTCGTCACCTTTTTCTGGTAC
ATCCGGCCCAAGGTGATGCATCTGCAGGCGCTGCCGCTACGGGCCTGGCGGTTGGCGAGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail