Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06185
Gene name
Locationscaffold_07:1492216..1493734
Strand+
Gene length (bp)1518
Transcript length (bp)1215
Coding sequence length (bp)1215
Protein length (aa) 405

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10358 NT-C2 N-terminal C2 in EEIG1 and EHBP1 proteins 5.7E-22 7 120

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.7049 0.2478 0.0274 0.1067 0.1202 0.006 0.1661 0.4517 0.2483 0.0214

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5945
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3112
Ophiocordyceps australis map64 (Brazil) OphauB2|7425
Ophiocordyceps camponoti-floridani Ophcf2|06185 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|2394
Ophiocordyceps kimflemingae Ophio5|2003

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06185
MSSLISKTRKPKFELHLKIYDLNNVPLVSGQSFIKWHLAHSMHAEHRGRTAKCPVANHQVNYDFAKLVPSLRISV
DRNNQLAECPLELEVLQEFSVADKMSLGRIRLNLSEYVGESEKDSSALTNSTTGNMASSTGSLPRQPSVSSSAST
ARSSVVSASDVKTVEDGVVRRYLMQDSKVNSTLKIGILMVQIDGDRNYVAPVLRSAPVFGSIAGFQADDDAGFLP
NLTKSRDAYELQDLYRRSLAAAWLRQPSELPADECIEDIFSGGNGWKAVKSGANSTPDTDEDDNNNRPSNATLRP
NDLRRFQQQQHQHHPLPPPTQPQPPPRPHLQRLKRPQQQQHDLRDDEVASVRSASLGSLAPTLGSGSDADRRADD
GTSMRRLREVPESDLRSDLRAWELPGVAS*
Coding >Ophcf2|06185
ATGTCTTCGTTGATCAGCAAGACGCGCAAGCCCAAGTTCGAGCTGCATCTCAAGATCTACGACCTGAACAACGTC
CCCCTCGTCTCAGGCCAATCCTTCATAAAATGGCACCTCGCCCACTCAATGCACGCCGAGCACCGCGGCCGAACA
GCAAAATGCCCCGTCGCAAACCACCAAGTCAACTACGACTTCGCCAAGCTGGTGCCCTCGCTGCGCATCTCCGTC
GACAGGAACAACCAGCTGGCAGAGTGTCCGCTGGAGCTCGAGGTGCTGCAGGAGTTTAGCGTGGCGGATAAGATG
TCGCTCGGGCGCATACGGCTTAACCTTAGCGAGTATGTGGGCGAGAGCGAGAAGGATTCGTCTGCCCTGACCAAC
TCGACGACTGGGAATATGGCTTCTTCGACGGGGTCGTTGCCGAGACAACCTTCTGTCAGTAGCAGCGCATCAACG
GCTCGATCTTCGGTTGTCTCGGCGTCGGACGTCAAGACGGTTGAGGACGGCGTGGTGCGTCGCTATCTGATGCAA
GATAGCAAAGTCAACAGCACCCTCAAGATCGGCATCCTCATGGTCCAGATCGACGGCGACCGCAACTACGTCGCG
CCCGTCCTCCGCTCGGCCCCCGTCTTCGGCTCCATCGCCGGCTTCCAAGCCGACGACGACGCCGGCTTCCTCCCG
AACCTCACAAAGAGCCGAGACGCCTACGAGCTGCAAGATCTATACCGCCGCTCCCTGGCCGCCGCCTGGCTCCGT
CAACCGTCCGAACTCCCGGCTGACGAATGCATCGAAGACATCTTCTCCGGCGGCAACGGCTGGAAAGCCGTCAAG
AGCGGCGCCAACTCGACGCCCGACACGGACGAAGATGATAACAACAACCGGCCTTCCAACGCCACCCTCCGCCCC
AACGACCTCCGCCGTTTCCAACAACAACAACATCAACATCACCCCCTCCCCCCCCCAACACAGCCCCAGCCGCCA
CCACGGCCGCACCTTCAGCGCCTCAAGCGACCGCAGCAGCAGCAACACGACCTGCGAGACGACGAAGTGGCCAGC
GTCCGCAGCGCCAGCCTCGGCAGTCTCGCGCCTACGCTCGGTAGCGGTAGTGACGCTGATCGCAGGGCCGATGAC
GGTACGTCCATGAGGCGGCTGAGGGAAGTGCCGGAGTCGGATCTTCGCTCTGATCTGAGGGCTTGGGAATTGCCT
GGCGTGGCGTCATAA
Transcript >Ophcf2|06185
ATGTCTTCGTTGATCAGCAAGACGCGCAAGCCCAAGTTCGAGCTGCATCTCAAGATCTACGACCTGAACAACGTC
CCCCTCGTCTCAGGCCAATCCTTCATAAAATGGCACCTCGCCCACTCAATGCACGCCGAGCACCGCGGCCGAACA
GCAAAATGCCCCGTCGCAAACCACCAAGTCAACTACGACTTCGCCAAGCTGGTGCCCTCGCTGCGCATCTCCGTC
GACAGGAACAACCAGCTGGCAGAGTGTCCGCTGGAGCTCGAGGTGCTGCAGGAGTTTAGCGTGGCGGATAAGATG
TCGCTCGGGCGCATACGGCTTAACCTTAGCGAGTATGTGGGCGAGAGCGAGAAGGATTCGTCTGCCCTGACCAAC
TCGACGACTGGGAATATGGCTTCTTCGACGGGGTCGTTGCCGAGACAACCTTCTGTCAGTAGCAGCGCATCAACG
GCTCGATCTTCGGTTGTCTCGGCGTCGGACGTCAAGACGGTTGAGGACGGCGTGGTGCGTCGCTATCTGATGCAA
GATAGCAAAGTCAACAGCACCCTCAAGATCGGCATCCTCATGGTCCAGATCGACGGCGACCGCAACTACGTCGCG
CCCGTCCTCCGCTCGGCCCCCGTCTTCGGCTCCATCGCCGGCTTCCAAGCCGACGACGACGCCGGCTTCCTCCCG
AACCTCACAAAGAGCCGAGACGCCTACGAGCTGCAAGATCTATACCGCCGCTCCCTGGCCGCCGCCTGGCTCCGT
CAACCGTCCGAACTCCCGGCTGACGAATGCATCGAAGACATCTTCTCCGGCGGCAACGGCTGGAAAGCCGTCAAG
AGCGGCGCCAACTCGACGCCCGACACGGACGAAGATGATAACAACAACCGGCCTTCCAACGCCACCCTCCGCCCC
AACGACCTCCGCCGTTTCCAACAACAACAACATCAACATCACCCCCTCCCCCCCCCAACACAGCCCCAGCCGCCA
CCACGGCCGCACCTTCAGCGCCTCAAGCGACCGCAGCAGCAGCAACACGACCTGCGAGACGACGAAGTGGCCAGC
GTCCGCAGCGCCAGCCTCGGCAGTCTCGCGCCTACGCTCGGTAGCGGTAGTGACGCTGATCGCAGGGCCGATGAC
GGTACGTCCATGAGGCGGCTGAGGGAAGTGCCGGAGTCGGATCTTCGCTCTGATCTGAGGGCTTGGGAATTGCCT
GGCGTGGCGTCATAA
Gene >Ophcf2|06185
ATGTCTTCGTTGAGTGAGTGACGATAAGAGCCCTTGAAACTTGGGCCTGCTAACAACCAGCAAGTCAGCAAGACG
CGCAAGGTAAAGAGACAAGATCTTAGGCCTCTTCCTCGACCCTCAACTCTCAGCAGACTAACCCCTTGACCCAGC
CCAAGTTCGAGCTGCATCTCAAGGCAAGACGCGAAAACCTAACCTCCCAGCACATCATCGGCGATCCTCAAACTA
AGCAAGCTTTCCCAGATCTACGACCTGAACAACGTCCCCCTCGTCTCAGGCCAATCCTTCATAAAATGGCACCTC
GCCCACTCAATGCACGCCGAGCACCGCGGCCGAACAGCAAAATGCCCCGTCGCAAACCACCAAGTCAACTACGAC
TTCGCCAAGCTGGTGCCCTCGCTGCGCATCTCCGTCGACAGGAACAACCAGCTGGCAGAGTGTCCGCTGGAGCTC
GAGGTGCTGCAGGAGTTTAGCGTGGCGGATAAGATGTCGCTCGGGCGCATACGGCTTAACCTTAGCGAGTATGTG
GGCGAGAGCGAGAAGGATTCGTCTGCCCTGACCAACTCGACGACTGGGAATATGGCTTCTTCGACGGGGTCGTTG
CCGAGACAACCTTCTGTCAGTAGCAGCGCATCAACGGCTCGATCTTCGGTTGTCTCGGCGTCGGACGTCAAGACG
GTTGAGGACGGCGTGGTGCGTCGCTATCTGATGCAAGATAGCAAAGTCAACAGCACCCTCAAGATCGGCATCCTC
ATGGTCCAGATCGACGGCGACCGCAACTACGTCGCGCCCGTCCTCCGCTCGGCCCCCGTCTTCGGCTCCATCGCC
GGCTTCCAAGCCGACGACGACGCCGGCTGTACCGTCCCCTCCGCGTCCCCTCGTCCCCAGGTCTCCTCGCTGACT
CTATACCGACAGTCCTCCCGAACCTCACAAAGAGCCGAGACGCCTACGAGCTGCAAGATCTATACCGCCGCTCCC
TGGCCGCCGCCTGGCTCCGTCAACCGTCCGAACTCCCGGCTGACGAATGCATCGAAGACATCTTCTCCGGCGGCA
ACGGCTGGAAAGCCGTCAAGAGCGGCGCCAACTCGACGCCCGACACGGACGAAGATGATAACAACAACCGGCCTT
CCAACGCCACCCTCCGCCCCAACGACCTCCGCCGTTTCCAACAACAACAACATCAACATCACCCCCTCCCCCCCC
CAACACAGCCCCAGCCGCCACCACGGCCGCACCTTCAGCGCCTCAAGCGACCGCAGCAGCAGCAACACGGTAACA
GCCCGTCCGCCGACACGCCGCACCGTCCGCATCGCCCGTCCCGGCAGCCGAGACCTGCGAGACGACGAAGTGGCC
AGCGTCCGCAGCGCCAGCCTCGGCAGTCTCGCGCCTACGCTCGGTAGCGGTAGTGACGCTGATCGCAGGGCCGAT
GACGGTACGTCCATGAGGCGGCTGAGGGAAGTGCCGGAGTCGGATCTTCGCTCTGATCTGAGGGCTTGGGAATTG
CCTGGCGTGGCGTCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail