Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06181
Gene name
Locationscaffold_07:1481988..1483068
Strand+
Gene length (bp)1080
Transcript length (bp)1032
Coding sequence length (bp)1032
Protein length (aa) 344

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00108 Thiolase_N Thiolase, N-terminal domain 4.3E-71 6 258
PF02803 Thiolase_C Thiolase, C-terminal domain 1.9E-13 270 327

GO

GO Term Description Terminal node
GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No
GO:0016746 acyltransferase activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06181
MDTPVVYIVGAARTPVAQVNGPLSQFSAAQLGAAAIQGAMKRSRVPPELVSHVYMGHALQAGCGQSPSKQAAIYA
GLSETIEATTINKVCASGLKAVTLAAQEILLGLDSVRVAGGMESMSNVPSYVDTKFFSWRGKGQNGVTKDGLLNP
YDGLSMGACADLIAARFELSKESQDEYALASFKRASQAVEMDVFREEVVPVPYQPGGSGQVSNDDIRGKALFQRL
KTLNPAFSAAGTITGGTSCTIADGASAVVLTNAQVARQHCKENSMLARIVSFADAAAKPKEFSVAPAKAAEIALE
RAKLAVDDISLWEINEAFAAVVLINQKVRRSWLGNSSLKGDAG*
Coding >Ophcf2|06181
ATGGACACGCCGGTCGTCTACATCGTGGGCGCCGCTCGGACGCCCGTTGCTCAGGTCAACGGACCGCTCTCGCAA
TTCTCGGCTGCTCAACTCGGCGCCGCAGCGATACAAGGCGCAATGAAACGATCACGGGTACCGCCAGAGCTGGTC
TCGCACGTCTACATGGGCCACGCCTTGCAGGCCGGCTGCGGTCAGTCGCCGAGCAAGCAGGCCGCCATCTACGCT
GGCCTATCGGAGACGATCGAAGCGACGACAATCAACAAGGTCTGCGCATCGGGACTCAAGGCCGTCACGCTGGCG
GCTCAGGAGATTCTCCTCGGTCTCGACTCCGTGCGGGTGGCGGGCGGTATGGAGAGCATGTCCAACGTGCCCTCG
TACGTGGACACGAAGTTTTTCAGCTGGCGAGGGAAGGGACAGAATGGCGTGACCAAGGACGGACTGCTGAACCCG
TACGATGGCCTATCCATGGGGGCTTGTGCTGATCTTATCGCTGCGCGGTTTGAGCTGTCCAAGGAAAGCCAGGAC
GAGTACGCTCTGGCTTCGTTCAAACGCGCAAGTCAGGCTGTTGAGATGGACGTCTTCCGCGAAGAGGTAGTCCCG
GTGCCGTATCAGCCGGGAGGGTCGGGCCAGGTGTCAAACGACGACATCAGGGGCAAGGCCTTGTTTCAAAGATTA
AAGACACTGAATCCGGCCTTCTCTGCCGCCGGGACCATTACCGGGGGAACCTCGTGCACGATTGCCGATGGCGCT
TCAGCTGTTGTTTTGACCAACGCTCAAGTCGCGCGCCAACATTGCAAAGAAAACTCCATGTTGGCACGCATCGTC
TCCTTCGCCGACGCTGCAGCGAAGCCCAAAGAGTTTTCCGTAGCGCCGGCAAAAGCTGCCGAGATTGCGCTCGAA
AGGGCAAAGTTGGCAGTCGACGACATCTCTCTTTGGGAAATCAACGAGGCCTTTGCGGCCGTTGTGCTGATAAAC
CAAAAGGTGAGACGGAGCTGGCTAGGCAATTCCAGTCTGAAAGGTGATGCTGGGTAA
Transcript >Ophcf2|06181
ATGGACACGCCGGTCGTCTACATCGTGGGCGCCGCTCGGACGCCCGTTGCTCAGGTCAACGGACCGCTCTCGCAA
TTCTCGGCTGCTCAACTCGGCGCCGCAGCGATACAAGGCGCAATGAAACGATCACGGGTACCGCCAGAGCTGGTC
TCGCACGTCTACATGGGCCACGCCTTGCAGGCCGGCTGCGGTCAGTCGCCGAGCAAGCAGGCCGCCATCTACGCT
GGCCTATCGGAGACGATCGAAGCGACGACAATCAACAAGGTCTGCGCATCGGGACTCAAGGCCGTCACGCTGGCG
GCTCAGGAGATTCTCCTCGGTCTCGACTCCGTGCGGGTGGCGGGCGGTATGGAGAGCATGTCCAACGTGCCCTCG
TACGTGGACACGAAGTTTTTCAGCTGGCGAGGGAAGGGACAGAATGGCGTGACCAAGGACGGACTGCTGAACCCG
TACGATGGCCTATCCATGGGGGCTTGTGCTGATCTTATCGCTGCGCGGTTTGAGCTGTCCAAGGAAAGCCAGGAC
GAGTACGCTCTGGCTTCGTTCAAACGCGCAAGTCAGGCTGTTGAGATGGACGTCTTCCGCGAAGAGGTAGTCCCG
GTGCCGTATCAGCCGGGAGGGTCGGGCCAGGTGTCAAACGACGACATCAGGGGCAAGGCCTTGTTTCAAAGATTA
AAGACACTGAATCCGGCCTTCTCTGCCGCCGGGACCATTACCGGGGGAACCTCGTGCACGATTGCCGATGGCGCT
TCAGCTGTTGTTTTGACCAACGCTCAAGTCGCGCGCCAACATTGCAAAGAAAACTCCATGTTGGCACGCATCGTC
TCCTTCGCCGACGCTGCAGCGAAGCCCAAAGAGTTTTCCGTAGCGCCGGCAAAAGCTGCCGAGATTGCGCTCGAA
AGGGCAAAGTTGGCAGTCGACGACATCTCTCTTTGGGAAATCAACGAGGCCTTTGCGGCCGTTGTGCTGATAAAC
CAAAAGGTGAGACGGAGCTGGCTAGGCAATTCCAGTCTGAAAGGTGATGCTGGGTAA
Gene >Ophcf2|06181
ATGGACACGCCGGTCGTCTACATCGTGGGCGCCGCTCGGACGCCCGTTGCTCAGGTTCTGATGCCAGCCGACGCG
ACGATACAAGTCATCTAACAGCAGCAGGTCAACGGACCGCTCTCGCAATTCTCGGCTGCTCAACTCGGCGCCGCA
GCGATACAAGGCGCAATGAAACGATCACGGGTACCGCCAGAGCTGGTCTCGCACGTCTACATGGGCCACGCCTTG
CAGGCCGGCTGCGGTCAGTCGCCGAGCAAGCAGGCCGCCATCTACGCTGGCCTATCGGAGACGATCGAAGCGACG
ACAATCAACAAGGTCTGCGCATCGGGACTCAAGGCCGTCACGCTGGCGGCTCAGGAGATTCTCCTCGGTCTCGAC
TCCGTGCGGGTGGCGGGCGGTATGGAGAGCATGTCCAACGTGCCCTCGTACGTGGACACGAAGTTTTTCAGCTGG
CGAGGGAAGGGACAGAATGGCGTGACCAAGGACGGACTGCTGAACCCGTACGATGGCCTATCCATGGGGGCTTGT
GCTGATCTTATCGCTGCGCGGTTTGAGCTGTCCAAGGAAAGCCAGGACGAGTACGCTCTGGCTTCGTTCAAACGC
GCAAGTCAGGCTGTTGAGATGGACGTCTTCCGCGAAGAGGTAGTCCCGGTGCCGTATCAGCCGGGAGGGTCGGGC
CAGGTGTCAAACGACGACATCAGGGGCAAGGCCTTGTTTCAAAGATTAAAGACACTGAATCCGGCCTTCTCTGCC
GCCGGGACCATTACCGGGGGAACCTCGTGCACGATTGCCGATGGCGCTTCAGCTGTTGTTTTGACCAACGCTCAA
GTCGCGCGCCAACATTGCAAAGAAAACTCCATGTTGGCACGCATCGTCTCCTTCGCCGACGCTGCAGCGAAGCCC
AAAGAGTTTTCCGTAGCGCCGGCAAAAGCTGCCGAGATTGCGCTCGAAAGGGCAAAGTTGGCAGTCGACGACATC
TCTCTTTGGGAAATCAACGAGGCCTTTGCGGCCGTTGTGCTGATAAACCAAAAGGTGAGACGGAGCTGGCTAGGC
AATTCCAGTCTGAAAGGTGATGCTGGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail