Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06176
Gene name
Locationscaffold_07:1465553..1467405
Strand+
Gene length (bp)1852
Transcript length (bp)1644
Coding sequence length (bp)1644
Protein length (aa) 548

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01494 FAD_binding_3 FAD binding domain 6.0E-75 5 358

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0000166 nucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0036094 small molecule binding No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 21 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06176
MDLTTDFLIVGCGPAGASLACFLGSHGLTGIVIGAASGTADTPRAHITNMAALECLRDIGLEREVERVASRSGCM
EHTRWCYSMAGVEFARVYAWGHDPRRMGDYALASPCTPADVPQTLLEPILIRYATQHGFHVRFDTKLTAIDIQDE
TIQATVLDTLSHSRYRIQARYLLAADGARSLVVRELDLPLRKRPGQGTAYNVLVRADMEHLVRARSGNLHWVVRP
DVEGGVFAAVGIVRMVRTWDEWIFILFPGREGVDPSEEQCWRRVRLLIGDETPFEVVGVSKWQINHVVAESFCLG
DAVHRHPPMNGLGSNTCIQDAYNLAWKLALVHKGQAGHSLLETYDAERQPVGVEVVSRANQAFKDHARLWAALGV
TSTEGDGARALQELVEVGERGERRRRELRLGVEETTAEFHGLGVEMGQRYCSEAIFDADEPEPWKAKGRAAEDPV
RYYEPGTYPGSRLPHAWLNKAIPAKATSTLDVAGHGRFVLLTGVGGSAWKTEAEKVSATLGVEMEAVSIGFRQDW
EDVYFEWERVRGVGRGGCVGQA*
Coding >Ophcf2|06176
ATGGACCTCACAACCGACTTCCTCATCGTCGGCTGCGGCCCCGCCGGCGCCTCTTTGGCTTGTTTCCTCGGCTCA
CACGGCCTCACCGGCATCGTCATCGGCGCGGCCTCCGGGACGGCGGACACGCCGCGGGCGCACATCACTAACATG
GCAGCTCTGGAGTGTCTTCGGGACATCGGGCTCGAGAGGGAGGTTGAGAGGGTGGCTTCGAGGTCTGGGTGTATG
GAGCATACGCGGTGGTGCTATTCCATGGCTGGCGTCGAGTTCGCGCGCGTTTATGCTTGGGGGCATGATCCTAGA
AGGATGGGAGATTATGCCCTGGCCAGTCCCTGCACTCCAGCAGACGTTCCGCAGACGCTCCTGGAGCCGATACTG
ATCCGCTACGCGACCCAGCACGGCTTCCACGTCCGCTTCGACACCAAGCTCACGGCCATAGACATCCAAGACGAG
ACGATCCAAGCAACGGTCCTCGACACCCTCTCCCACTCACGATACCGCATCCAAGCCCGCTACCTCCTCGCCGCA
GACGGAGCCCGCAGCCTCGTCGTCCGCGAGCTGGACCTGCCCCTCCGCAAGAGGCCCGGCCAGGGAACGGCGTAC
AACGTGCTGGTCCGGGCGGACATGGAGCATCTTGTCCGGGCGCGGTCTGGGAATCTGCATTGGGTTGTGAGGCCG
GATGTCGAGGGGGGGGTGTTTGCGGCTGTGGGGATTGTGAGGATGGTGAGGACGTGGGATGAGTGGATCTTCATC
TTGTTTCCTGGGAGGGAGGGGGTTGATCCTTCTGAGGAGCAGTGTTGGAGGAGGGTGAGGCTTCTTATTGGGGAC
GAGACGCCCTTCGAGGTCGTGGGGGTGTCCAAGTGGCAGATCAACCATGTCGTGGCCGAGAGCTTCTGTCTCGGA
GACGCCGTCCACCGTCATCCGCCCATGAACGGCCTCGGCAGCAACACCTGCATCCAAGACGCCTACAATCTAGCC
TGGAAACTGGCCCTCGTGCACAAAGGCCAAGCCGGACATTCCCTGCTGGAGACGTACGACGCCGAACGACAGCCC
GTTGGCGTCGAGGTCGTCTCCCGCGCGAACCAGGCGTTCAAGGATCATGCTCGGTTGTGGGCTGCGCTGGGCGTG
ACGTCGACCGAGGGGGATGGGGCGCGTGCGCTCCAGGAGCTGGTTGAGGTCGGTGAACGGGGGGAGAGGCGGAGG
AGGGAGTTGCGTCTCGGTGTTGAGGAGACGACGGCTGAGTTTCACGGGTTGGGTGTTGAGATGGGACAGAGGTAT
TGCAGCGAGGCCATCTTCGACGCTGATGAGCCGGAGCCGTGGAAGGCCAAGGGAAGGGCAGCAGAGGATCCGGTC
CGATACTACGAGCCGGGAACATACCCCGGAAGCCGCCTCCCACACGCCTGGCTGAACAAGGCGATTCCCGCAAAG
GCGACATCAACCCTCGACGTGGCGGGCCACGGGCGCTTCGTGCTCTTGACGGGGGTGGGGGGCTCTGCGTGGAAG
ACGGAGGCCGAAAAGGTATCCGCGACTCTGGGCGTGGAGATGGAGGCGGTTTCCATTGGCTTCCGGCAGGATTGG
GAGGATGTGTATTTCGAGTGGGAGAGGGTCAGGGGCGTGGGGAGGGGGGGCTGTGTTGGTCAGGCCTGA
Transcript >Ophcf2|06176
ATGGACCTCACAACCGACTTCCTCATCGTCGGCTGCGGCCCCGCCGGCGCCTCTTTGGCTTGTTTCCTCGGCTCA
CACGGCCTCACCGGCATCGTCATCGGCGCGGCCTCCGGGACGGCGGACACGCCGCGGGCGCACATCACTAACATG
GCAGCTCTGGAGTGTCTTCGGGACATCGGGCTCGAGAGGGAGGTTGAGAGGGTGGCTTCGAGGTCTGGGTGTATG
GAGCATACGCGGTGGTGCTATTCCATGGCTGGCGTCGAGTTCGCGCGCGTTTATGCTTGGGGGCATGATCCTAGA
AGGATGGGAGATTATGCCCTGGCCAGTCCCTGCACTCCAGCAGACGTTCCGCAGACGCTCCTGGAGCCGATACTG
ATCCGCTACGCGACCCAGCACGGCTTCCACGTCCGCTTCGACACCAAGCTCACGGCCATAGACATCCAAGACGAG
ACGATCCAAGCAACGGTCCTCGACACCCTCTCCCACTCACGATACCGCATCCAAGCCCGCTACCTCCTCGCCGCA
GACGGAGCCCGCAGCCTCGTCGTCCGCGAGCTGGACCTGCCCCTCCGCAAGAGGCCCGGCCAGGGAACGGCGTAC
AACGTGCTGGTCCGGGCGGACATGGAGCATCTTGTCCGGGCGCGGTCTGGGAATCTGCATTGGGTTGTGAGGCCG
GATGTCGAGGGGGGGGTGTTTGCGGCTGTGGGGATTGTGAGGATGGTGAGGACGTGGGATGAGTGGATCTTCATC
TTGTTTCCTGGGAGGGAGGGGGTTGATCCTTCTGAGGAGCAGTGTTGGAGGAGGGTGAGGCTTCTTATTGGGGAC
GAGACGCCCTTCGAGGTCGTGGGGGTGTCCAAGTGGCAGATCAACCATGTCGTGGCCGAGAGCTTCTGTCTCGGA
GACGCCGTCCACCGTCATCCGCCCATGAACGGCCTCGGCAGCAACACCTGCATCCAAGACGCCTACAATCTAGCC
TGGAAACTGGCCCTCGTGCACAAAGGCCAAGCCGGACATTCCCTGCTGGAGACGTACGACGCCGAACGACAGCCC
GTTGGCGTCGAGGTCGTCTCCCGCGCGAACCAGGCGTTCAAGGATCATGCTCGGTTGTGGGCTGCGCTGGGCGTG
ACGTCGACCGAGGGGGATGGGGCGCGTGCGCTCCAGGAGCTGGTTGAGGTCGGTGAACGGGGGGAGAGGCGGAGG
AGGGAGTTGCGTCTCGGTGTTGAGGAGACGACGGCTGAGTTTCACGGGTTGGGTGTTGAGATGGGACAGAGGTAT
TGCAGCGAGGCCATCTTCGACGCTGATGAGCCGGAGCCGTGGAAGGCCAAGGGAAGGGCAGCAGAGGATCCGGTC
CGATACTACGAGCCGGGAACATACCCCGGAAGCCGCCTCCCACACGCCTGGCTGAACAAGGCGATTCCCGCAAAG
GCGACATCAACCCTCGACGTGGCGGGCCACGGGCGCTTCGTGCTCTTGACGGGGGTGGGGGGCTCTGCGTGGAAG
ACGGAGGCCGAAAAGGTATCCGCGACTCTGGGCGTGGAGATGGAGGCGGTTTCCATTGGCTTCCGGCAGGATTGG
GAGGATGTGTATTTCGAGTGGGAGAGGGTCAGGGGCGTGGGGAGGGGGGGCTGTGTTGGTCAGGCCTGA
Gene >Ophcf2|06176
ATGGACCTCACAACCGACTTCCTCATCGTCGGCTGCGGCCCCGCCGGCGCCTCTTTGGCTTGTTTCCTCGGCTCA
CACGGTAAGCCGACCGGCCCCGGCCTCGCCCCGGCCCCGGCCCCGGCCCCGTCCCCGGCGCTAACCGGACAGGCC
TCACCGGCATCGTCATCGGCGCGGCCTCCGGGACGGCGGACACGCCGCGGGCGCACATCACTAACATGGCAGCTC
TGGAGTGTCTTCGGGACATCGGGCTCGAGAGGGAGGTTGAGAGGGTGGCTTCGAGGTCTGGGTGTATGGAGCATA
CGCGGTGGTGCTATTCCATGGCTGGCGTCGAGTTCGCGCGCGTTTATGCTTGGGGGCATGATCCTAGAAGGATGG
TGAGCATGTTGATTGACGAGGGGTCATGAAACGGATCGGCTGACGTTTTATACATGTAGGGAGATTATGCCCTGG
CCAGTCCCTGCACTCCAGCAGACGTTCCGCAGACGCTCCTGGAGCCGATACTGATCCGCTACGCGACCCAGCACG
GCTTCCACGTCCGCTTCGACACCAAGCTCACGGCCATAGACATCCAAGACGAGACGATCCAAGCAACGGTCCTCG
ACACCCTCTCCCACTCACGATACCGCATCCAAGCCCGCTACCTCCTCGCCGCAGACGGAGCCCGCAGCCTCGTCG
TCCGCGAGCTGGACCTGCCCCTCCGCAAGAGGCCCGGCCAGGGAACGGCGTACAACGTGCTGGTCCGGGCGGACA
TGGAGCATCTTGTCCGGGCGCGGTCTGGGAATCTGCATTGGGTTGTGAGGCCGGATGTCGAGGGGGGGGTGTTTG
CGGCTGTGGGGATTGTGAGGATGGTGAGGACGTGGGATGAGTGGATCTTCATCTTGTTTCCTGGGAGGGAGGGGG
TTGATCCTTCTGAGGAGCAGTGTTGGAGGAGGGTGAGGCTTCTTATTGGGGACGAGACGCCCTTCGAGGTCGTGG
GGGTGTCCAAGTGGCAGATCAACCATGTCGTGGCCGAGAGGTATTCCAAGGGAAACGTGTATGACTCTCCGCCGC
TTTGTCTCGGACAACTCTTTTTCCTCTTTTGCTGACGGCATCAAGCTTCTGTCTCGGAGACGCCGTCCACCGTCA
TCCGCCCATGAACGGCCTCGGCAGCAACACCTGCATCCAAGACGCCTACAATCTAGCCTGGAAACTGGCCCTCGT
GCACAAAGGCCAAGCCGGACATTCCCTGCTGGAGACGTACGACGCCGAACGACAGCCCGTTGGCGTCGAGGTCGT
CTCCCGCGCGAACCAGGCGTTCAAGGATCATGCTCGGTTGTGGGCTGCGCTGGGCGTGACGTCGACCGAGGGGGA
TGGGGCGCGTGCGCTCCAGGAGCTGGTTGAGGTCGGTGAACGGGGGGAGAGGCGGAGGAGGGAGTTGCGTCTCGG
TGTTGAGGAGACGACGGCTGAGTTTCACGGGTTGGGTGTTGAGATGGGACAGAGGTATTGCAGCGAGGCCATCTT
CGACGCTGATGAGCCGGAGCCGTGGAAGGCCAAGGGAAGGGCAGCAGAGGATCCGGTCCGATACTACGAGCCGGG
AACATACCCCGGAAGCCGCCTCCCACACGCCTGGCTGAACAAGGCGATTCCCGCAAAGGCGACATCAACCCTCGA
CGTGGCGGGCCACGGGCGCTTCGTGCTCTTGACGGGGGTGGGGGGCTCTGCGTGGAAGACGGAGGCCGAAAAGGT
ATCCGCGACTCTGGGCGTGGAGATGGAGGCGGTTTCCATTGGCTTCCGGCAGGATTGGGAGGATGTGTATTTCGA
GTGGGAGAGGGTCAGGGGCGTGGGGAGGGGGGGCTGTGTTGGTCAGGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail