Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06159
Gene name
Locationscaffold_07:1418953..1421547
Strand-
Gene length (bp)2594
Transcript length (bp)2397
Coding sequence length (bp)2397
Protein length (aa) 799

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03169 OPT OPT oligopeptide transporter protein 1.6E-178 99 754

GO

GO Term Description Terminal node
GO:0035673 oligopeptide transmembrane transporter activity Yes
GO:1904680 peptide transmembrane transporter activity No
GO:0042887 amide transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0003674 molecular_function No
GO:0005215 transporter activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 70 0.45

Transmembrane Domains

Domain # Start End Length
1 101 123 22
2 175 197 22
3 207 229 22
4 234 256 22
5 271 290 19
6 297 314 17
7 329 351 22
8 358 380 22
9 424 446 22
10 478 500 22
11 505 527 22
12 534 556 22
13 588 610 22
14 630 649 19
15 659 676 17
16 683 700 17
17 704 721 17
18 734 756 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06159
MVPSVFRKRHEPEEVTPIPAALESNASGVDHLKHLHEFEKAHKLDPNLPIDDLNDVDAAIAMGNAEKGIEIEHAL
MEDNSPYPEVRAVVRNYDVDVPVNTIRAWVIGMLLCSVGSSINMIFSLRYPSITITTYVVQLIAYPIGRGWDMVM
PDRVWNLCGLKFNLRPGKFNYKEHVIIVAMSNAAYGGGALYANDVIIAQKIFYGQDFGMAFQILFGITTLCTGYG
LAGLARRFLVWPAAMIWPADLVNCALFYTLHDHSTSDPTKTNGWSIGRYKLFLIIFCGGFFYYWFPGWIFKGLSL
FAWVCWLAPNNLVINKLFGVQHGYGLMPITFDWSIISGFINSPLIPPFHAIANVLGSIMIFFVIASIGIHFTGAL
YADYVPVQSSESYDNTGNVYNVSRVLDANYQFNETAYKEYSPLYLSTQFALSYGLSFAAMASVIIHVALYHGKEI
WRQFRMARHQEDDVHMRLMKKYRDAEDWWYAALFIVMVAVSFGVVTGWPTGFPPWAFVICLLLPIVWLIPIGLIQ
AITNIQLGLNVLTELIIGYMAPGRPLVMMLFKNYGYISMSQALYFAQDLKLGHYMKVPPRVMFSSQLVASIWSAT
LQICVLNWALRNIPEVCTVTQPNNYSCPNSRVFYTASIVWGVIGPARIFSHGATYASLRWFWLVGTFTPVATWML
ARRWPKSFWRYVCTPIIFGGVGLLPPATVYIYLCWGVVGVIFGYFIKRRYTGWWLQYNYITSAALDCGLVCSTLV
IFFTLYLTSTSPPKWWGNDDIFKNLDHQNLAVTKRLPPGETFGPSVYP*
Coding >Ophcf2|06159
ATGGTGCCCTCCGTCTTCCGCAAGCGCCACGAGCCCGAGGAGGTGACGCCCATCCCGGCTGCTCTCGAGTCGAAC
GCGTCGGGCGTCGATCATCTCAAGCATCTTCACGAATTTGAAAAGGCTCACAAACTCGACCCCAACTTACCCATC
GACGACCTCAACGATGTCGACGCCGCCATCGCCATGGGAAATGCCGAGAAGGGCATCGAGATAGAGCACGCCCTC
ATGGAGGACAACAGTCCCTATCCAGAGGTCCGCGCTGTCGTCCGCAACTACGACGTAGACGTCCCCGTAAACACC
ATCCGAGCCTGGGTCATCGGCATGTTGCTGTGCTCCGTCGGCTCCAGCATCAACATGATCTTTTCTCTGCGCTAT
CCGAGCATCACCATTACCACCTACGTAGTTCAACTCATTGCTTATCCCATCGGCCGTGGTTGGGACATGGTCATG
CCGGACCGCGTCTGGAACCTTTGCGGCCTCAAGTTCAACCTCCGGCCCGGCAAGTTCAACTACAAGGAGCACGTA
ATCATCGTTGCCATGTCAAATGCCGCATACGGCGGAGGCGCTCTCTACGCCAACGACGTCATCATCGCCCAAAAG
ATCTTTTACGGCCAGGACTTTGGCATGGCCTTTCAGATTCTCTTTGGCATCACAACCCTCTGCACAGGCTATGGG
CTCGCCGGCCTGGCTCGCCGTTTCTTGGTATGGCCAGCCGCCATGATCTGGCCAGCCGACCTCGTCAACTGTGCT
CTCTTTTACACCCTGCACGATCACTCGACTTCGGATCCGACAAAGACCAACGGCTGGTCCATCGGCCGCTACAAG
CTGTTCCTCATCATCTTCTGCGGCGGCTTCTTTTACTACTGGTTCCCCGGCTGGATCTTCAAGGGTCTCTCCCTC
TTCGCCTGGGTCTGCTGGCTTGCCCCCAACAACCTGGTCATCAACAAGCTGTTTGGTGTCCAGCATGGCTATGGC
TTGATGCCCATCACCTTTGACTGGTCCATCATCAGCGGCTTCATCAACTCGCCTCTCATTCCGCCCTTTCACGCC
ATTGCAAACGTTCTCGGGAGCATCATGATCTTCTTCGTCATCGCCTCCATCGGCATCCACTTTACTGGCGCTCTC
TACGCCGACTACGTGCCCGTTCAGTCGTCCGAGTCGTACGACAACACGGGCAACGTCTACAATGTCAGTCGCGTC
CTGGATGCCAACTACCAGTTCAACGAGACGGCATACAAAGAATACTCGCCCCTGTATCTGTCGACCCAGTTCGCC
CTGTCCTACGGTCTCTCATTCGCTGCCATGGCCTCCGTCATCATCCACGTCGCTCTCTATCACGGCAAGGAGATC
TGGAGGCAGTTTAGGATGGCCCGTCACCAGGAGGACGACGTCCACATGCGCCTCATGAAAAAGTACCGCGACGCC
GAGGATTGGTGGTATGCTGCTCTGTTCATCGTCATGGTGGCCGTCTCGTTCGGCGTCGTCACCGGCTGGCCGACC
GGCTTCCCTCCCTGGGCCTTTGTCATCTGTCTGCTGCTGCCCATCGTCTGGCTCATCCCGATTGGTCTTATCCAG
GCCATCACCAACATCCAGCTCGGCCTCAACGTCCTCACGGAGCTCATCATTGGCTACATGGCGCCGGGCCGGCCG
CTCGTCATGATGCTGTTCAAGAACTACGGTTACATCTCCATGTCGCAGGCCCTCTACTTCGCGCAGGATCTCAAG
CTCGGTCACTACATGAAGGTGCCTCCGCGCGTCATGTTCTCGTCGCAGCTGGTGGCGTCGATCTGGTCGGCCACG
CTGCAGATCTGCGTCCTCAACTGGGCGCTGCGCAACATCCCCGAAGTCTGCACCGTCACGCAACCCAACAACTAC
AGCTGCCCCAACAGTCGCGTCTTCTACACGGCTTCCATCGTCTGGGGCGTCATCGGCCCAGCTCGCATCTTTAGC
CATGGGGCGACGTACGCCTCGCTGCGCTGGTTCTGGCTCGTCGGCACCTTTACGCCCGTCGCGACCTGGATGCTG
GCCCGTCGCTGGCCCAAGTCCTTCTGGCGCTACGTCTGCACCCCCATCATCTTCGGAGGCGTCGGCTTGCTCCCT
CCTGCCACCGTCTACATCTACTTGTGCTGGGGTGTGGTCGGCGTCATCTTTGGTTACTTCATCAAGCGTCGTTAT
ACCGGCTGGTGGCTGCAGTACAATTACATCACCTCAGCCGCTCTCGACTGCGGTCTCGTCTGCTCGACTCTCGTC
ATCTTCTTTACCCTGTACCTGACTTCGACGAGCCCGCCCAAGTGGTGGGGTAACGATGACATCTTCAAGAACCTC
GACCACCAGAACCTGGCCGTCACCAAGAGGCTACCGCCCGGAGAGACCTTTGGGCCTTCCGTCTATCCCTGA
Transcript >Ophcf2|06159
ATGGTGCCCTCCGTCTTCCGCAAGCGCCACGAGCCCGAGGAGGTGACGCCCATCCCGGCTGCTCTCGAGTCGAAC
GCGTCGGGCGTCGATCATCTCAAGCATCTTCACGAATTTGAAAAGGCTCACAAACTCGACCCCAACTTACCCATC
GACGACCTCAACGATGTCGACGCCGCCATCGCCATGGGAAATGCCGAGAAGGGCATCGAGATAGAGCACGCCCTC
ATGGAGGACAACAGTCCCTATCCAGAGGTCCGCGCTGTCGTCCGCAACTACGACGTAGACGTCCCCGTAAACACC
ATCCGAGCCTGGGTCATCGGCATGTTGCTGTGCTCCGTCGGCTCCAGCATCAACATGATCTTTTCTCTGCGCTAT
CCGAGCATCACCATTACCACCTACGTAGTTCAACTCATTGCTTATCCCATCGGCCGTGGTTGGGACATGGTCATG
CCGGACCGCGTCTGGAACCTTTGCGGCCTCAAGTTCAACCTCCGGCCCGGCAAGTTCAACTACAAGGAGCACGTA
ATCATCGTTGCCATGTCAAATGCCGCATACGGCGGAGGCGCTCTCTACGCCAACGACGTCATCATCGCCCAAAAG
ATCTTTTACGGCCAGGACTTTGGCATGGCCTTTCAGATTCTCTTTGGCATCACAACCCTCTGCACAGGCTATGGG
CTCGCCGGCCTGGCTCGCCGTTTCTTGGTATGGCCAGCCGCCATGATCTGGCCAGCCGACCTCGTCAACTGTGCT
CTCTTTTACACCCTGCACGATCACTCGACTTCGGATCCGACAAAGACCAACGGCTGGTCCATCGGCCGCTACAAG
CTGTTCCTCATCATCTTCTGCGGCGGCTTCTTTTACTACTGGTTCCCCGGCTGGATCTTCAAGGGTCTCTCCCTC
TTCGCCTGGGTCTGCTGGCTTGCCCCCAACAACCTGGTCATCAACAAGCTGTTTGGTGTCCAGCATGGCTATGGC
TTGATGCCCATCACCTTTGACTGGTCCATCATCAGCGGCTTCATCAACTCGCCTCTCATTCCGCCCTTTCACGCC
ATTGCAAACGTTCTCGGGAGCATCATGATCTTCTTCGTCATCGCCTCCATCGGCATCCACTTTACTGGCGCTCTC
TACGCCGACTACGTGCCCGTTCAGTCGTCCGAGTCGTACGACAACACGGGCAACGTCTACAATGTCAGTCGCGTC
CTGGATGCCAACTACCAGTTCAACGAGACGGCATACAAAGAATACTCGCCCCTGTATCTGTCGACCCAGTTCGCC
CTGTCCTACGGTCTCTCATTCGCTGCCATGGCCTCCGTCATCATCCACGTCGCTCTCTATCACGGCAAGGAGATC
TGGAGGCAGTTTAGGATGGCCCGTCACCAGGAGGACGACGTCCACATGCGCCTCATGAAAAAGTACCGCGACGCC
GAGGATTGGTGGTATGCTGCTCTGTTCATCGTCATGGTGGCCGTCTCGTTCGGCGTCGTCACCGGCTGGCCGACC
GGCTTCCCTCCCTGGGCCTTTGTCATCTGTCTGCTGCTGCCCATCGTCTGGCTCATCCCGATTGGTCTTATCCAG
GCCATCACCAACATCCAGCTCGGCCTCAACGTCCTCACGGAGCTCATCATTGGCTACATGGCGCCGGGCCGGCCG
CTCGTCATGATGCTGTTCAAGAACTACGGTTACATCTCCATGTCGCAGGCCCTCTACTTCGCGCAGGATCTCAAG
CTCGGTCACTACATGAAGGTGCCTCCGCGCGTCATGTTCTCGTCGCAGCTGGTGGCGTCGATCTGGTCGGCCACG
CTGCAGATCTGCGTCCTCAACTGGGCGCTGCGCAACATCCCCGAAGTCTGCACCGTCACGCAACCCAACAACTAC
AGCTGCCCCAACAGTCGCGTCTTCTACACGGCTTCCATCGTCTGGGGCGTCATCGGCCCAGCTCGCATCTTTAGC
CATGGGGCGACGTACGCCTCGCTGCGCTGGTTCTGGCTCGTCGGCACCTTTACGCCCGTCGCGACCTGGATGCTG
GCCCGTCGCTGGCCCAAGTCCTTCTGGCGCTACGTCTGCACCCCCATCATCTTCGGAGGCGTCGGCTTGCTCCCT
CCTGCCACCGTCTACATCTACTTGTGCTGGGGTGTGGTCGGCGTCATCTTTGGTTACTTCATCAAGCGTCGTTAT
ACCGGCTGGTGGCTGCAGTACAATTACATCACCTCAGCCGCTCTCGACTGCGGTCTCGTCTGCTCGACTCTCGTC
ATCTTCTTTACCCTGTACCTGACTTCGACGAGCCCGCCCAAGTGGTGGGGTAACGATGACATCTTCAAGAACCTC
GACCACCAGAACCTGGCCGTCACCAAGAGGCTACCGCCCGGAGAGACCTTTGGGCCTTCCGTCTATCCCTGA
Gene >Ophcf2|06159
ATGGTGCCCTCCGTCTTCCGCAAGCGCCACGAGCCCGAGGAGGTGACGCCCATCCCGGCTGCTCTCGAGTCGAAC
GCGTCGGGCGTCGATCATCTCAAGCATCTTCACGAATTTGAAAAGGCTCACAAACTCGACCCCAACTTACCCATC
GACGACCTCAACGATGTCGACGCCGCCATCGCCATGGGAAATGCCGAGAAGGGCATCGAGATAGAGCACGCCCTC
ATGGAGGACAACAGTCCCTATCCAGAGGTCATGACTACATCTGCATCTTTCACCACAATATCGCTAACGGCCAAG
GAATAGGTCCGCGCTGTCGTCCGCAACTACGACGTAGACGTCCCCGTAAACACCATCCGAGCCTGGGTCATCGGC
ATGTTGCTGTGCTCCGTCGGCTCCAGCATCAACATGATCTTTTCTCTGCGCTATCCGAGCATCACCATTACCACC
TACGTAGTTCAACTCATTGCTTATCCCATCGGCCGTGGTTGGGACATGGTCATGCCGGACCGCGTCTGGAACCTT
TGCGGCCTCAAGTTCAACCTCCGGCCCGGCAAGTTCAACTACAAGGAGCACGTAATCATCGTTGCCATGTCAAAT
GTGAGTTTCCTCAATTTTGGAGTCAACTATTTGCTTTTTCTCATGAGTCGAGTCCTCAAGGCCGCATACGGCGGA
GGCGCTCTCTACGCCAACGACGTCATCATCGCCCAAAAGATCTTTTACGGCCAGGACTTTGGCATGGCCTTTCAG
ATTCTCTTTGGCATCACAACCCTCTGCACAGGCTATGGGCTCGCCGGCCTGGCTCGCCGTTTCTTGGTATGGCCA
GCCGCCATGATCTGGCCAGCCGACCTCGTCAACTGTGCTCTCTTTTACACCCTGCACGATCACTCGACTTCGGAT
CCGACAAAGACCAACGGCTGGTCCATCGGCCGCTACAAGCTGTTCCTCATCATCTTCTGCGGCGGCTTCTTTTAC
TACTGGTTCCCCGGCTGGATCTTCAAGGGTCTCTCCCTCTTCGCCTGGGTCTGCTGGCTTGCCCCCAACAACCTG
GTCATCAACAAGCTGTTTGGTGTCCAGCATGGCTATGGCTTGATGCCCATCACCTTTGACTGGTCCATCATCAGC
GGCTTCATCAACTCGCCTCTCATTCCGCCCTTTCACGCCATTGCAAACGTTCTCGGGAGCATCATGATCTTCTTC
GTCATCGCCTCCATCGGCATCCACTTTACTGGCGCTCTCTACGCCGACTACGTGCCCGTTCAGTCGTCCGAGTCG
TACGACAACACGGGCAACGTCTACAATGTCAGTCGCGTCCTGGATGCCAACTACCAGTTCAACGAGACGGCATAC
AAAGAATACTCGCCCCTGTATCTGTCGACCCAGTTCGCCCTGTCCTACGGTCTCTCATTCGCTGCCATGGCCTCC
GTCATCATCCACGTCGCTCTCTATCACGGCAAGGAGATCTGGAGGCAGTTTAGGATGGCCCGTCACCAGGAGGAC
GACGTCCACATGCGCCTCATGAAAAAGTACCGCGACGCCGAGGATTGGTGGTATGCTGGTATGTTCTGTCCATGC
CTCGTCATCCGGTCCGTGTGAGCCTGCTGACCGCCTGCTCCCCCCCCCCCCCCCCCCCCAAAAAAGCTCTGTTCA
TCGTCATGGTGGCCGTCTCGTTCGGCGTCGTCACCGGCTGGCCGACCGGCTTCCCTCCCTGGGCCTTTGTCATCT
GTCTGCTGCTGCCCATCGTCTGGCTCATCCCGATTGGTCTTATCCAGGCCATCACCAACATCCAGCTCGGCCTCA
ACGTCCTCACGGAGCTCATCATTGGCTACATGGCGCCGGGCCGGCCGCTCGTCATGATGCTGTTCAAGAACTACG
GTTACATCTCCATGTCGCAGGCCCTCTACTTCGCGCAGGATCTCAAGCTCGGTCACTACATGAAGGTGCCTCCGC
GCGTCATGTTCTCGTCGCAGCTGGTGGCGTCGATCTGGTCGGCCACGCTGCAGATCTGCGTCCTCAACTGGGCGC
TGCGCAACATCCCCGAAGTCTGCACCGTCACGCAACCCAACAACTACAGCTGCCCCAACAGTCGCGTCTTCTACA
CGGCTTCCATCGTCTGGGGCGTCATCGGCCCAGCTCGCATCTTTAGCCATGGGGCGACGTACGCCTCGCTGCGCT
GGTTCTGGCTCGTCGGCACCTTTACGCCCGTCGCGACCTGGATGCTGGCCCGTCGCTGGCCCAAGTCCTTCTGGC
GCTACGTCTGCACCCCCATCATCTTCGGAGGCGTCGGCTTGCTCCCTCCTGCCACCGTCTACATCTACTTGTGCT
GGGGTGTGGTCGGCGTCATCTTTGGTTACTTCATCAAGCGTCGTTATACCGGCTGGTGGCTGCAGTACAATTACA
TCACCTCAGCCGCTCTCGACTGCGGTCTCGTCTGCTCGACTCTCGTCATCTTCTTTACCCTGTACCTGACTTCGA
CGAGCCCGCCCAAGTGGTGGGGTAACGATGACATCTTCAAGAACCTCGACCACCAGAACCTGGCCGTCACCAAGA
GGCTACCGCCCGGAGAGACCTTTGGGCCTTCCGTCTATCCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail