Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06154
Gene name
Locationscaffold_07:1407905..1410113
Strand+
Gene length (bp)2208
Transcript length (bp)2073
Coding sequence length (bp)2073
Protein length (aa) 691

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 1.1E-38 150 630
PF00083 Sugar_tr Sugar (and other) transporter 3.0E-09 168 311

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 170 192 22
3 199 216 17
4 231 250 19
5 257 279 22
6 284 306 22
7 469 491 22
8 511 533 22
9 554 576 22
10 586 608 22
11 620 642 22
12 652 674 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06154
MSSPSSPASWKLPTAIARRLSSAWQGSSTNKSDRPKWSMGVLNDKETDEVPGSVLLLASSDRNEPLGLGNIRART
SHSSLPTGLERRQSSRPPLEPIDEKKTTSDGAIILEPQPDDSANDPLNWPGWRRDTALLSLGFYCMIGGGITPLI
AAGFTDVARDFHVDVESVSLTTGLYMMGLGLGSVLVSPTAILFGKRPVYLGSAIVFIATCLWAAWSPSFSSLLAA
RVFQGIAISPVECLPSATIAEIFFLHERAYRIGIYTLLLLGGKNLVPLVSAAIISRFGWRWVFWTVAAIVGLGFV
LLFLFVPETFWDRTPTKRPSNRPSLLNRLSSRLVVHRLVTGSSSSTRGLPSPGATVRQSDLHVGFVEPQTPDWVV
PPSPHQPHQPDQQTGYFRHVRDDSADNSSYAARAPPSLDMEKMTASALAASPKTQAYTHNLRQQPAQTFVQQLRP
FHGRLNNDKWFKVMLRPFVLFAYPSVLWAAAVYSCSIGWLIVISETMAVIYRDPTLYNFSALQTGLVYISPFIGG
ILGTGVAGKVSDVIVRAMSRRNGGLYEPEFRLVMVIPVMLSTCIGLMGFGWSAQNKDPWIVPTIFFGILSFGCSL
GSTTSITYCVDSYRQYAGEALVTLNFAKNICHGLVFSLFVAHWMAKDGPRLVYIWLGVIQVLVLLTTVPMYIYGK
RARMWTARRNLMEKF*
Coding >Ophcf2|06154
ATGTCGTCTCCGTCGTCACCTGCCAGCTGGAAACTGCCCACGGCCATCGCAAGGCGGCTGTCGTCGGCATGGCAG
GGCTCCTCCACCAACAAGTCGGATCGTCCCAAGTGGAGCATGGGCGTCCTCAACGACAAGGAGACGGACGAGGTT
CCCGGTTCCGTCCTGCTGCTGGCCTCGTCGGACCGCAACGAGCCGCTGGGGCTGGGCAACATACGGGCGCGGACC
TCGCACTCGTCGCTCCCCACGGGCCTGGAGAGGCGGCAGTCGTCTCGACCGCCTCTCGAGCCCATCGACGAGAAG
AAGACGACGAGCGACGGCGCCATCATCCTCGAGCCACAGCCCGACGACTCGGCCAACGATCCTCTGAACTGGCCC
GGCTGGCGACGCGACACGGCCCTGCTGTCTCTGGGCTTCTACTGCATGATTGGCGGCGGCATCACGCCCCTCATC
GCCGCCGGCTTCACCGACGTCGCGCGTGACTTTCATGTCGACGTCGAGAGCGTTTCCCTCACCACGGGTCTCTAC
ATGATGGGTCTTGGTCTGGGCTCCGTTCTCGTCTCTCCCACAGCAATACTGTTTGGAAAACGACCCGTCTACCTT
GGTAGCGCCATCGTCTTCATCGCCACCTGTCTGTGGGCGGCATGGTCGCCCAGCTTTTCCTCCCTACTGGCGGCC
CGCGTCTTCCAGGGCATCGCCATCAGCCCGGTCGAGTGCCTGCCGTCGGCCACGATTGCCGAGATCTTCTTTCTG
CACGAGCGAGCCTATCGGATCGGCATCTATACCCTACTGCTGCTGGGCGGCAAGAACCTGGTTCCGCTGGTGAGC
GCCGCCATCATCAGCCGCTTTGGCTGGCGCTGGGTGTTTTGGACCGTGGCTGCCATCGTCGGCCTCGGCTTCGTC
CTCCTCTTCCTCTTCGTCCCGGAGACGTTTTGGGACCGGACGCCGACCAAGAGACCCTCGAACCGACCGAGTCTG
CTGAACCGGCTGTCGTCGCGTCTGGTCGTCCATCGGCTGGTCACAGGCAGTAGCAGCAGTACCAGGGGCCTCCCT
TCGCCCGGGGCGACTGTCCGTCAGAGCGACCTCCACGTGGGCTTCGTCGAGCCGCAGACGCCGGACTGGGTGGTT
CCCCCTTCGCCGCACCAGCCGCATCAGCCGGACCAGCAGACGGGCTACTTCAGGCACGTCCGCGACGACAGCGCC
GACAACAGCTCCTACGCGGCCCGGGCGCCCCCTAGCCTGGATATGGAGAAGATGACGGCCTCGGCACTGGCGGCG
TCGCCCAAGACGCAGGCCTACACGCATAACCTGCGTCAGCAGCCGGCACAGACGTTCGTTCAGCAGCTCAGGCCC
TTCCACGGCCGGCTCAACAACGACAAGTGGTTCAAGGTGATGCTGCGGCCGTTTGTCCTGTTCGCCTACCCTTCG
GTTCTCTGGGCCGCGGCCGTCTACTCGTGCTCCATCGGCTGGCTCATCGTCATCTCCGAGACCATGGCCGTCATC
TACCGCGACCCGACCCTGTACAACTTCTCGGCGCTACAGACGGGCCTCGTCTACATCTCGCCCTTTATCGGCGGC
ATCCTGGGCACGGGCGTGGCCGGTAAGGTCAGCGACGTCATCGTACGGGCCATGTCACGACGCAACGGCGGACTT
TACGAGCCCGAGTTCCGGCTGGTCATGGTGATTCCCGTCATGCTGTCGACGTGTATAGGGCTCATGGGCTTCGGC
TGGTCGGCCCAGAACAAGGATCCGTGGATCGTGCCGACCATCTTCTTTGGCATCCTGTCGTTTGGCTGTTCGCTG
GGGTCGACGACGTCGATCACCTACTGCGTCGACAGCTACCGTCAGTACGCGGGCGAGGCGCTCGTCACGCTCAAC
TTTGCCAAGAATATCTGTCACGGCCTCGTCTTTAGCCTGTTCGTCGCCCACTGGATGGCCAAGGACGGGCCGAGG
CTGGTCTATATCTGGCTGGGCGTCATTCAGGTGCTGGTCCTGCTGACGACGGTCCCCATGTATATATACGGGAAG
CGGGCGCGCATGTGGACGGCGAGACGGAATCTGATGGAGAAGTTTTGA
Transcript >Ophcf2|06154
ATGTCGTCTCCGTCGTCACCTGCCAGCTGGAAACTGCCCACGGCCATCGCAAGGCGGCTGTCGTCGGCATGGCAG
GGCTCCTCCACCAACAAGTCGGATCGTCCCAAGTGGAGCATGGGCGTCCTCAACGACAAGGAGACGGACGAGGTT
CCCGGTTCCGTCCTGCTGCTGGCCTCGTCGGACCGCAACGAGCCGCTGGGGCTGGGCAACATACGGGCGCGGACC
TCGCACTCGTCGCTCCCCACGGGCCTGGAGAGGCGGCAGTCGTCTCGACCGCCTCTCGAGCCCATCGACGAGAAG
AAGACGACGAGCGACGGCGCCATCATCCTCGAGCCACAGCCCGACGACTCGGCCAACGATCCTCTGAACTGGCCC
GGCTGGCGACGCGACACGGCCCTGCTGTCTCTGGGCTTCTACTGCATGATTGGCGGCGGCATCACGCCCCTCATC
GCCGCCGGCTTCACCGACGTCGCGCGTGACTTTCATGTCGACGTCGAGAGCGTTTCCCTCACCACGGGTCTCTAC
ATGATGGGTCTTGGTCTGGGCTCCGTTCTCGTCTCTCCCACAGCAATACTGTTTGGAAAACGACCCGTCTACCTT
GGTAGCGCCATCGTCTTCATCGCCACCTGTCTGTGGGCGGCATGGTCGCCCAGCTTTTCCTCCCTACTGGCGGCC
CGCGTCTTCCAGGGCATCGCCATCAGCCCGGTCGAGTGCCTGCCGTCGGCCACGATTGCCGAGATCTTCTTTCTG
CACGAGCGAGCCTATCGGATCGGCATCTATACCCTACTGCTGCTGGGCGGCAAGAACCTGGTTCCGCTGGTGAGC
GCCGCCATCATCAGCCGCTTTGGCTGGCGCTGGGTGTTTTGGACCGTGGCTGCCATCGTCGGCCTCGGCTTCGTC
CTCCTCTTCCTCTTCGTCCCGGAGACGTTTTGGGACCGGACGCCGACCAAGAGACCCTCGAACCGACCGAGTCTG
CTGAACCGGCTGTCGTCGCGTCTGGTCGTCCATCGGCTGGTCACAGGCAGTAGCAGCAGTACCAGGGGCCTCCCT
TCGCCCGGGGCGACTGTCCGTCAGAGCGACCTCCACGTGGGCTTCGTCGAGCCGCAGACGCCGGACTGGGTGGTT
CCCCCTTCGCCGCACCAGCCGCATCAGCCGGACCAGCAGACGGGCTACTTCAGGCACGTCCGCGACGACAGCGCC
GACAACAGCTCCTACGCGGCCCGGGCGCCCCCTAGCCTGGATATGGAGAAGATGACGGCCTCGGCACTGGCGGCG
TCGCCCAAGACGCAGGCCTACACGCATAACCTGCGTCAGCAGCCGGCACAGACGTTCGTTCAGCAGCTCAGGCCC
TTCCACGGCCGGCTCAACAACGACAAGTGGTTCAAGGTGATGCTGCGGCCGTTTGTCCTGTTCGCCTACCCTTCG
GTTCTCTGGGCCGCGGCCGTCTACTCGTGCTCCATCGGCTGGCTCATCGTCATCTCCGAGACCATGGCCGTCATC
TACCGCGACCCGACCCTGTACAACTTCTCGGCGCTACAGACGGGCCTCGTCTACATCTCGCCCTTTATCGGCGGC
ATCCTGGGCACGGGCGTGGCCGGTAAGGTCAGCGACGTCATCGTACGGGCCATGTCACGACGCAACGGCGGACTT
TACGAGCCCGAGTTCCGGCTGGTCATGGTGATTCCCGTCATGCTGTCGACGTGTATAGGGCTCATGGGCTTCGGC
TGGTCGGCCCAGAACAAGGATCCGTGGATCGTGCCGACCATCTTCTTTGGCATCCTGTCGTTTGGCTGTTCGCTG
GGGTCGACGACGTCGATCACCTACTGCGTCGACAGCTACCGTCAGTACGCGGGCGAGGCGCTCGTCACGCTCAAC
TTTGCCAAGAATATCTGTCACGGCCTCGTCTTTAGCCTGTTCGTCGCCCACTGGATGGCCAAGGACGGGCCGAGG
CTGGTCTATATCTGGCTGGGCGTCATTCAGGTGCTGGTCCTGCTGACGACGGTCCCCATGTATATATACGGGAAG
CGGGCGCGCATGTGGACGGCGAGACGGAATCTGATGGAGAAGTTTTGA
Gene >Ophcf2|06154
ATGTCGTCTCCGTCGTCACCTGCCAGCTGGAAACTGCCCACGGCCATCGCAAGGCGGCTGTCGTCGGCATGGCAG
GGCTCCTCCACCAACAAGTCGGATCGTCCCAAGTGGAGCATGGGCGTCCTCAACGACAAGGAGACGGACGAGGTT
CCCGGTACGGTGGATGGCTTGGCGGAGACGAGGCTGAATGAAAGGCTGACTGACCCGTCCGTCGCCTTTAGGTTC
CGTCCTGCTGCTGGCCTCGTCGGACCGCAACGAGCCGCTGGGGCTGGGCAACATACGGGCGCGGACCTCGCACTC
GTCGCTCCCCACGGGCCTGGAGAGGCGGCAGTCGTCTCGACCGCCTCTCGAGCCCATCGACGAGAAGAAGACGAC
GAGCGACGGCGCCATCATCCTCGAGCCACAGCCCGACGACTCGGCCAACGATCCTCTGAACTGGCCCGGCTGGCG
ACGCGACACGGCCCTGCTGTCTCTGGGCTTCTACTGCATGATTGGCGGCGGCATCACGCCCCTCATCGCCGCCGG
CTTCACCGACGTCGCGCGTGACTTTCATGTCGACGTCGAGAGCGTTTCCCTCACCACGGGTCTCTACATGATGGG
TCTTGGTCTGGGCTCCGTTCTCGTCTCTCCCACAGCAATACTGTTTGGAAAACGACCCGTCTACCTTGGTAGCGC
CATCGTCTTCATCGCCACCTGTCTGTGGGCGGCATGGTCGCCCAGCTTTTCCTCCCTACTGGCGGCCCGCGTCTT
CCAGGGCATCGCCATCAGCCCGGTCGAGTGCCTGCCGTCGGCCACGATTGCCGAGATCTTCTTTCTGCACGAGCG
AGCCTATCGGATCGGCATCTATACCCTACTGCTGCTGGGCGGCAAGAACCTGGTTCCGCTGGTGAGCGCCGCCAT
CATCAGCCGCTTTGGCTGGCGCTGGGTGTTTTGGTCCGTCTTCCCTTTTTTTTTTTTTTTCCCTATCCTTCCGTC
CCTTCTATTCTGACTGACAATTCCAGGACCGTGGCTGCCATCGTCGGCCTCGGCTTCGTCCTCCTCTTCCTCTTC
GTCCCGGAGACGTTTTGGGACCGGACGCCGACCAAGAGACCCTCGAACCGACCGAGTCTGCTGAACCGGCTGTCG
TCGCGTCTGGTCGTCCATCGGCTGGTCACAGGCAGTAGCAGCAGTACCAGGGGCCTCCCTTCGCCCGGGGCGACT
GTCCGTCAGAGCGACCTCCACGTGGGCTTCGTCGAGCCGCAGACGCCGGACTGGGTGGTTCCCCCTTCGCCGCAC
CAGCCGCATCAGCCGGACCAGCAGACGGGCTACTTCAGGCACGTCCGCGACGACAGCGCCGACAACAGCTCCTAC
GCGGCCCGGGCGCCCCCTAGCCTGGATATGGAGAAGATGACGGCCTCGGCACTGGCGGCGTCGCCCAAGACGCAG
GCCTACACGCATAACCTGCGTCAGCAGCCGGCACAGACGTTCGTTCAGCAGCTCAGGCCCTTCCACGGCCGGCTC
AACAACGACAAGTGGTTCAAGGTGATGCTGCGGCCGTTTGTCCTGTTCGCCTACCCTTCGGTTCTCTGGGCCGCG
GCCGTCTACTCGTGCTCCATCGGCTGGCTCATCGTCATCTCCGAGACCATGGCCGTCATCTACCGCGACCCGACC
CTGTACAACTTCTCGGCGCTACAGACGGGCCTCGTCTACATCTCGCCCTTTATCGGCGGCATCCTGGGCACGGGC
GTGGCCGGTAAGGTCAGCGACGTCATCGTACGGGCCATGTCACGACGCAACGGCGGACTTTACGAGCCCGAGTTC
CGGCTGGTCATGGTGATTCCCGTCATGCTGTCGACGTGTATAGGGCTCATGGGCTTCGGCTGGTCGGCCCAGAAC
AAGGATCCGTGGATCGTGCCGACCATCTTCTTTGGCATCCTGTCGTTTGGCTGTTCGCTGGGGTCGACGACGTCG
ATCACCTACTGCGTCGACAGCTACCGTCAGTACGCGGGCGAGGCGCTCGTCACGCTCAACTTTGCCAAGAATATC
TGTCACGGCCTCGTCTTTAGCCTGTTCGTCGCCCACTGGATGGCCAAGGACGGGCCGAGGCTGGTCTATATCTGG
CTGGGCGTCATTCAGGTGCTGGTCCTGCTGACGACGGTCCCCATGTATATATACGGGAAGCGGGCGCGCATGTGG
ACGGCGAGACGGAATCTGATGGAGAAGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail