Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06149
Gene name
Locationscaffold_07:1394067..1396809
Strand+
Gene length (bp)2742
Transcript length (bp)1668
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03630 Fumble Fumble 1.1E-142 199 524
PF00067 p450 Cytochrome P450 6.6E-23 4 87

GO

GO Term Description Terminal node
GO:0004594 pantothenate kinase activity Yes
GO:0005524 ATP binding Yes
GO:0004497 monooxygenase activity Yes
GO:0015937 coenzyme A biosynthetic process Yes
GO:0016705 oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen Yes
GO:0020037 heme binding Yes
GO:0005506 iron ion binding Yes
GO:0009058 biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0008152 metabolic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009260 ribonucleotide biosynthetic process No
GO:0043167 ion binding No
GO:0016491 oxidoreductase activity No
GO:0033865 nucleoside bisphosphate metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0044238 primary metabolic process No
GO:0009117 nucleotide metabolic process No
GO:0046390 ribose phosphate biosynthetic process No
GO:0019693 ribose phosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006163 purine nucleotide metabolic process No
GO:0044237 cellular metabolic process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0043168 anion binding No
GO:0046483 heterocycle metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009150 purine ribonucleotide metabolic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034033 purine nucleoside bisphosphate biosynthetic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0003674 molecular_function No
GO:0017076 purine nucleotide binding No
GO:0000166 nucleotide binding No
GO:0006164 purine nucleotide biosynthetic process No
GO:0036094 small molecule binding No
GO:0044249 cellular biosynthetic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0046872 metal ion binding No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:1901576 organic substance biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0046914 transition metal ion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0033875 ribonucleoside bisphosphate metabolic process No
GO:0032553 ribonucleotide binding No
GO:0090407 organophosphate biosynthetic process No
GO:0034030 ribonucleoside bisphosphate biosynthetic process No
GO:0034032 purine nucleoside bisphosphate metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0006796 phosphate-containing compound metabolic process No
GO:0008150 biological_process No
GO:0030554 adenyl nucleotide binding No
GO:0033866 nucleoside bisphosphate biosynthetic process No
GO:1901265 nucleoside phosphate binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019637 organophosphate metabolic process No
GO:0071704 organic substance metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:0046906 tetrapyrrole binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0043169 cation binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0097367 carbohydrate derivative binding No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0003824 catalytic activity No
GO:1901360 organic cyclic compound metabolic process No
GO:1901137 carbohydrate derivative biosynthetic process No
GO:0009259 ribonucleotide metabolic process No
GO:0015936 coenzyme A metabolic process No
GO:0009152 purine ribonucleotide biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06149
MIMFPDIQRKCQEEIDRVVGTGRLPTFEDRDNLPYVDAMLKELFRWNTVAPFGAAHIASEELTCDGYTIPKGSVL
IATAWSMCHDPSSLHIPPSLGPLSTPVNAPAQRLSPTAMTPPVEDNDEGRSGARGGSRTSTMDDIDSTITRPGSV
KINVKGAFIVDADTCSPAPGQALASGSGSPTHRETSDIRLPNHTAVVSHIAIDIGGSLIKLVYFSREAHSTEPGG
RLNFQNFETDRVDDCVELMKHLRDKHLMLETARQSELCVMATGGGAYKFYDKIRDALGVDVLREDEMECLIIGLD
FFITEIPREVFTYSDADPMHFVSPRERIYPYLLVNIGSGVSFLKVTGQRSYQRVGGTSLGGGTLWGLLSLLTGAR
TFGDMLDLAGEGDNAKVDMLVGDIYGTDYGKIGLKSTAIASSFGKVFRLKSAAEAASADAGVSPAPEFGDSDISR
SLLYAISNNIGHIAFLQSQIHNLSDIYFGGSFIRGHRQTMNTLSYAIKFWSKGSKQAYFLRHEGYLGAVGAFLKR
QPKNWGRRGSLEGLDALQELKVSGKTKESL*
Coding >Ophcf2|06149
ATGATCATGTTCCCCGATATTCAACGCAAATGCCAGGAAGAAATCGACCGCGTCGTTGGCACCGGACGGCTGCCC
ACCTTTGAGGACCGAGACAACCTGCCATACGTAGACGCCATGCTCAAGGAACTCTTTCGCTGGAACACCGTAGCG
CCATTCGGAGCGGCGCACATTGCGAGCGAGGAACTTACTTGCGACGGCTACACCATTCCCAAGGGATCTGTCCTG
ATTGCAACCGCATGGTCCATGTGCCACGACCCGAGCTCCCTTCACATTCCGCCCTCGCTCGGCCCTCTTTCTACC
CCCGTCAATGCGCCCGCCCAGCGACTGTCGCCCACAGCCATGACTCCCCCCGTCGAGGACAACGACGAGGGCCGG
TCCGGCGCGAGGGGTGGCTCTAGGACGTCGACTATGGACGACATCGATAGCACCATCACGAGGCCTGGAAGCGTC
AAGATCAACGTCAAGGGCGCCTTCATCGTCGACGCTGATACGTGTTCGCCTGCCCCGGGACAGGCTCTGGCCAGC
GGCAGCGGAAGTCCGACTCACCGCGAGACGAGCGACATTCGCCTTCCGAATCACACGGCCGTTGTGAGCCACATT
GCTATCGATATTGGCGGCTCGCTCATCAAGCTTGTTTACTTCTCGCGCGAGGCTCACTCGACTGAGCCAGGCGGC
CGGCTCAACTTTCAGAACTTCGAGACTGACCGTGTCGATGACTGCGTCGAGCTCATGAAACACCTGCGCGATAAG
CACCTCATGCTCGAAACTGCTCGGCAAAGTGAGCTGTGCGTCATGGCCACTGGGGGCGGCGCTTACAAGTTCTAC
GACAAGATACGCGATGCCCTCGGCGTCGACGTGCTGCGCGAAGATGAAATGGAGTGCCTCATAATCGGCCTCGAC
TTCTTCATCACCGAGATCCCTCGTGAAGTCTTTACCTATTCTGACGCAGACCCTATGCACTTTGTCAGTCCTCGC
GAGCGCATATACCCGTATCTGCTCGTCAACATCGGTTCCGGTGTTTCCTTTCTCAAGGTCACCGGACAGCGGTCC
TACCAGCGAGTCGGCGGCACCTCTCTGGGTGGTGGAACACTCTGGGGCTTGCTCTCTCTGCTCACGGGCGCGCGC
ACCTTTGGCGATATGCTGGATCTGGCCGGCGAAGGCGATAATGCCAAGGTCGACATGCTCGTCGGTGACATTTAC
GGCACCGACTACGGCAAGATCGGCCTCAAGAGCACCGCCATCGCCTCCTCCTTCGGCAAGGTCTTTCGGCTCAAG
AGCGCTGCCGAGGCCGCCTCAGCCGACGCCGGCGTTTCGCCCGCTCCCGAATTCGGCGACAGTGACATATCGCGA
TCGTTACTGTATGCCATATCCAACAACATTGGCCACATTGCCTTTTTGCAGTCGCAAATTCACAATCTGTCCGAC
ATTTACTTTGGGGGATCTTTTATCCGCGGACATCGCCAGACGATGAACACGCTGAGCTACGCCATCAAGTTCTGG
AGTAAAGGTTCCAAGCAGGCCTACTTTCTGCGACACGAGGGCTACCTCGGCGCTGTCGGCGCCTTTCTCAAGAGG
CAGCCGAAGAATTGGGGTCGCAGAGGTAGCCTCGAAGGCCTGGATGCGCTGCAGGAGCTCAAGGTGAGCGGTAAG
ACCAAGGAGAGCTTGTGA
Transcript >Ophcf2|06149
ATGATCATGTTCCCCGATATTCAACGCAAATGCCAGGAAGAAATCGACCGCGTCGTTGGCACCGGACGGCTGCCC
ACCTTTGAGGACCGAGACAACCTGCCATACGTAGACGCCATGCTCAAGGAACTCTTTCGCTGGAACACCGTAGCG
CCATTCGGAGCGGCGCACATTGCGAGCGAGGAACTTACTTGCGACGGCTACACCATTCCCAAGGGATCTGTCCTG
ATTGCAACCGCATGGTCCATGTGCCACGACCCGAGCTCCCTTCACATTCCGCCCTCGCTCGGCCCTCTTTCTACC
CCCGTCAATGCGCCCGCCCAGCGACTGTCGCCCACAGCCATGACTCCCCCCGTCGAGGACAACGACGAGGGCCGG
TCCGGCGCGAGGGGTGGCTCTAGGACGTCGACTATGGACGACATCGATAGCACCATCACGAGGCCTGGAAGCGTC
AAGATCAACGTCAAGGGCGCCTTCATCGTCGACGCTGATACGTGTTCGCCTGCCCCGGGACAGGCTCTGGCCAGC
GGCAGCGGAAGTCCGACTCACCGCGAGACGAGCGACATTCGCCTTCCGAATCACACGGCCGTTGTGAGCCACATT
GCTATCGATATTGGCGGCTCGCTCATCAAGCTTGTTTACTTCTCGCGCGAGGCTCACTCGACTGAGCCAGGCGGC
CGGCTCAACTTTCAGAACTTCGAGACTGACCGTGTCGATGACTGCGTCGAGCTCATGAAACACCTGCGCGATAAG
CACCTCATGCTCGAAACTGCTCGGCAAAGTGAGCTGTGCGTCATGGCCACTGGGGGCGGCGCTTACAAGTTCTAC
GACAAGATACGCGATGCCCTCGGCGTCGACGTGCTGCGCGAAGATGAAATGGAGTGCCTCATAATCGGCCTCGAC
TTCTTCATCACCGAGATCCCTCGTGAAGTCTTTACCTATTCTGACGCAGACCCTATGCACTTTGTCAGTCCTCGC
GAGCGCATATACCCGTATCTGCTCGTCAACATCGGTTCCGGTGTTTCCTTTCTCAAGGTCACCGGACAGCGGTCC
TACCAGCGAGTCGGCGGCACCTCTCTGGGTGGTGGAACACTCTGGGGCTTGCTCTCTCTGCTCACGGGCGCGCGC
ACCTTTGGCGATATGCTGGATCTGGCCGGCGAAGGCGATAATGCCAAGGTCGACATGCTCGTCGGTGACATTTAC
GGCACCGACTACGGCAAGATCGGCCTCAAGAGCACCGCCATCGCCTCCTCCTTCGGCAAGGTCTTTCGGCTCAAG
AGCGCTGCCGAGGCCGCCTCAGCCGACGCCGGCGTTTCGCCCGCTCCCGAATTCGGCGACAGTGACATATCGCGA
TCGTTACTGTATGCCATATCCAACAACATTGGCCACATTGCCTTTTTGCAGTCGCAAATTCACAATCTGTCCGAC
ATTTACTTTGGGGGATCTTTTATCCGCGGACATCGCCAGACGATGAACACGCTGAGCTACGCCATCAAGTTCTGG
AGTAAAGGTTCCAAGCAGGCCTACTTTCTGCGACACGAGGGCTACCTCGGCGCTGTCGGCGCCTTTCTCAAGAGG
CAGCCGAAGAATTGGGGTCGCAGAGGTAGCCTCGAAGGCCTGGATGCGCTGCAGGAGCTCAAGGTGAGCGGTAAG
ACCAAGGAGAGCTTGTGA
Gene >Ophcf2|06149
ATGATCATGTTCCCCGATATTCAACGCAAATGCCAGGAAGAAATCGACCGCGTCGTTGGCACCGGACGGCTGCCC
ACCTTTGAGGACCGAGACAACCTGCCATACGTAGACGCCATGCTCAAGGAACTCTTTCGCTGGAACACCGTAGCG
CCATTCGGAGCGGCGCACATTGCGAGCGAGGAACTTACTTGCGACGGCTACACCATTCCCAAGGGATCTGTCCTG
ATTGCAACCGCATGGTCCATGTGCCACGACCCGAGCGTATATCCAGATCCGACCGTCTTCGACCCCAACCGCTTT
CTCGGTCCCGACAAAGAAGCTGACCCGTGTGACTTAATCTTTGGTTTCGGCCGTCGCGTCTGCCCTGGACGCTTC
TTTGCGGACGCCAGCCTTTTCCTGGATATTGTAACGATTCTGTCGTTGTTTGACGTGAACAAGGGCGTCGACGAG
ATGGGCAACGAACTAGAGCCCGAGCTTCACGTTCGGCCGGGATTAATCAACAGTTCTTTACCGTTTCCTCATAAG
ATTACTCCGAGGGGCTCAAGTCAAGTGGCGCTGATCAGGCGTTTGGAGGGTGAGGTCTCGTGGAATAGTACTGAT
CCTTCACTTCTGGGCGAGATGCCAAGTATTGAGATTTAGGTGGCAAGGTGGCGGGTGGCAAGGTGGCGAAAGTCG
GGAACTGACGAGTGTGTAAGACAGACCGACTGAGATTATGTGTTTGCTGGGGCATATACTCGTAACTGTCCGGAG
AATCCATCTTCCATCTGTTGGGGTTGATTCTGGGAGGCTCTGTGTGATCCAGTTAACATATGTACGAATAGGCAG
CAGAGGTTTTCGTGCATACATACGCAAATGCCTTGAAAGAGCTAGCGCGCAAGTAATTGACACATGACGCGTATT
AATTCCGGCTTCTTTGTTCGTGCGGGTTACGGAGGTTGACAAAATAATGGTAGCGACGCCCGGGCTCTTTGAACG
AGTTCCATGTCAACGGATATATGGCAACTGACTAATATCTGCTCGCATGACGAAGCATCTACCCAGGCTATAGGG
TAGGTATCCGCCGGGCGGTGGACCCAGGTAATCCACCACAACCGAGCTTACATCATAGCTTCAAAGATAACCGGC
CAGCTTCCGAGCCTCCCTCTACAAATATCACGACGCTCGGCCATCTCGGCATTCTTACATCTCCCAAACGTCGCA
TGCTGGCTCGCAGTCCCTTCACATTCCGCCCTCGCTCGGCCCTCTTTCTACCCCCGTCAATGCGCCCGCCCAGCG
ACTGTCGCCCACAGCCATGACTCCCCCCGTCGAGGACAACGACGAGGGCCGGTCCGGCGCGAGGGGTGGCTCTAG
GACGTCGACTATGGACGACATCGATAGCACCATCACGAGGCCTGGAAGCGTCAAGATCAACGTCAAGGGCGCCTT
CATCGTCGACGCTGATACGTGTTCGCCTGCCCCGGGACAGGCTCTGGCCAGCGGCAGCGGAAGTCCGACTCACCG
CGAGACGAGCGACATTCGCCTTCCGAATCACACGGCCGTTGTGAGCCACATTGCTATCGATGTATGGCCTTTGCC
TCCCCTTCGTCTTCGTGCTTGTTTATGCTGACGTACCTCTGCTGGAAGATTGGCGGCTCGCTCATCAAGCTTGTT
TACTTCTCGCGCGAGGCTCACTCGACTGAGCCAGGCGGCCGGCTCAACTTTCAGAACTTCGAGACTGACCGTGTC
GATGACTGCGTCGAGCTCATGAAACACCTGCGCGATAAGCACCTCATGCTCGAAACTGCTCGGCAAAGTGAGCTG
TGCGTCATGGCCACTGGGGGCGGCGCTTACAAGTTCTACGACAAGATACGCGATGCCCTCGGCGTCGACGTGCTG
CGCGAAGATGAAATGGAGTGCCTCATAATCGGTTAGCTGCCCTGTATAGCTTTGCTGTCTTCTTCCTCTGAAGCT
GACGCTCTCTCCGCAGGCCTCGACTTCTTCATCACCGAGATCCCTCGTGAAGTCTTTACCTATTCTGACGCAGAC
CCTATGCACTTTGTCAGTCCTCGCGAGCGCATATACCCGTATCTGCTCGTCAACATCGGTTCCGGTGTTTCCTTT
CTCAAGGTCACCGGACAGCGGTCCTACCAGCGAGTCGGCGGCACCTCTCTGGGTGGTGGAACACTCTGGGGCTTG
CTCTCTCTGCTCACGGGCGCGCGCACCTTTGGCGATATGCTGGATCTGGCCGGCGAAGGCGATAATGCCAAGGTC
GACATGCTCGTCGGTGACATTTACGGCACCGACTACGGCAAGATCGGCCTCAAGAGCACCGCCATCGCCTCCTCC
TTCGGCAAGGTCTTTCGGCTCAAGAGCGCTGCCGAGGCCGCCTCAGCCGACGCCGGCGTTTCGCCCGCTCCCGAA
TTCGGCGACAGTGACATATCGCGATCGTTACTGTATGCCATATCCAACAACATTGGCCACATTGCCTTTTTGCAG
TCGCAAATTCACAATCTGTCCGACATTTACTTTGGGGGATCTTTTATCCGCGGACATCGCCAGACGATGAACACG
CTGAGCTACGCCATCAAGTTCTGGAGTAAAGGTTCCAAGCAGGCCTACTTTCTGCGACACGAGGGCTACCTCGGC
GCTGTCGGCGCCTTTCTCAAGAGGCAGCCGAAGAATTGGGGTCGCAGAGGTAGCCTCGAAGGCCTGGATGCGCTG
CAGGAGCTCAAGGTGAGCGGTAAGACCAAGGAGAGCTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail