Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06139
Gene name
Locationscaffold_07:1372246..1374802
Strand+
Gene length (bp)2556
Transcript length (bp)2403
Coding sequence length (bp)2403
Protein length (aa) 801

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12862 ANAPC5 Anaphase-promoting complex subunit 5 1.9E-33 294 383

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5292 0.6499 0.0821 0.0435 0.0821 0.0034 0.1957 0.2692 0.3184 0.0059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1947
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7281
Ophiocordyceps australis map64 (Brazil) OphauB2|5071
Ophiocordyceps camponoti-floridani Ophcf2|06139 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|4425
Ophiocordyceps kimflemingae Ophio5|3765
Ophiocordyceps subramaniannii Hirsu2|2090

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06139
MARYLTPAKIGLLALIELYTEESVPSEAVLPVLTFITSHILHDGSACGSREARWGKAERTVSLVISIGDFEKLLS
GFPVVTGMPGRKLWDLFLAKLWDVDSLDALHAFFEAVPAMLAKTKGEKQSGEEDEEEEEEEEEEQEEEQDQPSSK
KIKLSRNSPFGAFVRRCRLEFQRLAFHVCTELWKDFVRYRQTTAAYLRRKNPSLGRLGFDKVLLLGGQDDWDPDG
IAALVAVAYGDMLYGDESGTVAVSTDDIEGLVEFQIGRMQKYGNRVPVEIRLQFEHLLRDSSLVPSVRHYLSFLD
AWRAGDYTTAFDDLHRYFDYTMQYRDRLFYQYALMNLAVLQADFGCYREAVSAMLETVSTARENRDMTCLNFALN
WLFHFGRAHPKLVHDLESHSMLGAGKESLAFLRVKAKESGMWTLWSSVLLAESKMALVNGDSVATSVEHMVRSSQ
VIVDKRLKNMFGSQMSLQAALWSRLGIGRLSACASETFLRCHARNSVFEDELKHTCRLAFALAQRGRYDEALRRL
DGLDDDDSLRWSWKPSQYWLKYRAVVKLKRDLHHGNLDAARRLLDQLLQSKADDLEPDMAFTVDSLHVEYLSRRG
DVRAALTEVDSLMSRQRSEGRDVAEAVKLLLSRVSLLDRCGRPLRALSAAVRATDMAWRARLLPCLWEAVGALSS
MLVSLAEFDAAVSLLTAVIPRSLECEADAPVARLYSILADAQMGLAGAAEARSSRRTELLTRALRAVQKALHHYS
VVEDVERQCEAMAKKAMIMKLTGEAALAADYAAAYVELRKRAEALSLDGA*
Coding >Ophcf2|06139
ATGGCCCGTTACCTGACGCCAGCCAAGATCGGCCTGCTAGCCCTCATCGAGCTCTACACCGAAGAGTCAGTCCCT
AGCGAGGCGGTGCTCCCGGTGCTGACCTTTATCACGTCGCACATTCTCCACGACGGCAGCGCCTGTGGCTCGCGA
GAGGCGCGATGGGGCAAGGCGGAACGCACAGTCAGCCTCGTCATATCCATCGGCGACTTTGAGAAGCTGCTCAGC
GGCTTTCCCGTGGTGACGGGCATGCCAGGAAGGAAGTTGTGGGATCTTTTCCTCGCTAAGCTGTGGGATGTCGAC
TCTCTAGATGCGCTGCACGCCTTCTTCGAGGCTGTGCCTGCCATGCTAGCAAAGACAAAGGGCGAGAAACAAAGC
GGTGAGGAAGATGAAGAGGAGGAGGAGGAGGAGGAGGAGGAGCAAGAAGAGGAGCAAGATCAGCCGAGCAGCAAG
AAAATCAAGCTATCTCGAAACTCGCCGTTTGGCGCCTTTGTGCGCAGATGCCGGCTCGAGTTCCAGCGACTTGCC
TTTCACGTCTGCACAGAGCTCTGGAAAGACTTTGTGCGCTATCGTCAGACTACGGCCGCCTACCTGCGTCGCAAG
AACCCGTCCCTCGGACGTTTGGGCTTCGACAAGGTGCTGCTGCTCGGCGGTCAGGACGACTGGGATCCCGACGGG
ATAGCGGCTCTGGTTGCTGTCGCGTACGGGGATATGCTTTACGGTGACGAGAGCGGCACCGTGGCTGTGAGCACC
GATGACATCGAGGGTCTTGTCGAGTTTCAGATCGGACGTATGCAGAAGTACGGAAACAGAGTGCCTGTCGAGATA
CGGCTTCAGTTTGAGCATCTGCTTCGCGATAGCTCCCTCGTGCCCAGCGTAAGGCACTATCTCAGCTTCCTCGAC
GCCTGGAGAGCGGGCGACTACACAACGGCCTTTGACGACCTCCATCGATACTTCGACTACACCATGCAGTACCGC
GACCGGCTCTTCTACCAGTACGCCCTCATGAACCTGGCCGTCCTCCAGGCCGACTTCGGCTGCTATCGCGAGGCC
GTCTCGGCCATGCTAGAGACGGTTTCGACGGCCCGCGAGAACCGCGACATGACGTGCCTCAACTTTGCTCTCAAC
TGGCTCTTTCACTTCGGACGCGCCCACCCAAAGCTCGTTCACGACCTCGAGTCCCACAGCATGCTGGGAGCGGGT
AAAGAGAGCCTGGCGTTTCTACGAGTCAAGGCCAAGGAGTCGGGCATGTGGACGCTCTGGAGCTCGGTGCTTCTG
GCCGAGTCCAAGATGGCGCTCGTCAACGGAGACTCGGTGGCGACTTCGGTCGAACACATGGTGCGCAGCTCGCAA
GTCATCGTCGATAAGCGGCTCAAGAACATGTTTGGCTCGCAAATGTCGCTTCAGGCGGCGCTCTGGAGTCGACTC
GGGATAGGACGATTGTCAGCCTGCGCGTCAGAGACGTTCCTGCGCTGCCATGCTCGCAACTCGGTCTTTGAGGAC
GAACTGAAGCACACGTGCCGGCTGGCGTTTGCGCTCGCTCAGCGAGGGAGATATGACGAAGCGTTGCGAAGACTC
GACGGCCTCGATGACGACGACTCGCTCCGTTGGTCATGGAAGCCTAGTCAGTATTGGCTCAAGTACCGAGCCGTC
GTCAAGCTGAAGCGCGACTTGCATCACGGGAACCTGGACGCGGCCCGCCGGCTTCTGGACCAGCTTCTACAGTCC
AAGGCGGACGATCTGGAGCCGGACATGGCCTTTACCGTCGACTCGCTGCACGTCGAATATCTCTCACGCCGGGGC
GACGTCCGGGCAGCGCTGACCGAAGTGGACTCTCTGATGAGCCGTCAAAGGAGCGAGGGCCGGGACGTGGCCGAG
GCCGTCAAACTTCTCCTATCGCGCGTCTCGCTGCTGGACCGCTGTGGAAGGCCGCTGCGAGCGCTTTCGGCGGCG
GTGAGGGCAACGGACATGGCCTGGCGCGCACGGCTTCTCCCGTGCCTGTGGGAAGCGGTGGGCGCTCTGTCATCG
ATGCTGGTGTCTCTGGCCGAGTTCGACGCAGCCGTCAGTCTCCTCACGGCGGTGATCCCACGCTCTCTAGAGTGC
GAGGCCGACGCGCCGGTCGCCCGCCTTTATTCCATCCTGGCAGACGCGCAGATGGGTCTCGCCGGCGCGGCAGAG
GCCCGTTCCAGTCGGCGGACGGAGCTGCTGACGCGGGCGCTTCGGGCGGTCCAGAAGGCGCTGCATCATTACTCG
GTTGTCGAGGACGTGGAGCGCCAGTGCGAGGCCATGGCTAAGAAGGCCATGATCATGAAGCTCACGGGCGAGGCG
GCGCTGGCGGCTGACTATGCCGCTGCCTACGTGGAGTTGCGGAAGAGAGCCGAGGCGCTGAGCCTGGATGGGGCG
TGA
Transcript >Ophcf2|06139
ATGGCCCGTTACCTGACGCCAGCCAAGATCGGCCTGCTAGCCCTCATCGAGCTCTACACCGAAGAGTCAGTCCCT
AGCGAGGCGGTGCTCCCGGTGCTGACCTTTATCACGTCGCACATTCTCCACGACGGCAGCGCCTGTGGCTCGCGA
GAGGCGCGATGGGGCAAGGCGGAACGCACAGTCAGCCTCGTCATATCCATCGGCGACTTTGAGAAGCTGCTCAGC
GGCTTTCCCGTGGTGACGGGCATGCCAGGAAGGAAGTTGTGGGATCTTTTCCTCGCTAAGCTGTGGGATGTCGAC
TCTCTAGATGCGCTGCACGCCTTCTTCGAGGCTGTGCCTGCCATGCTAGCAAAGACAAAGGGCGAGAAACAAAGC
GGTGAGGAAGATGAAGAGGAGGAGGAGGAGGAGGAGGAGGAGCAAGAAGAGGAGCAAGATCAGCCGAGCAGCAAG
AAAATCAAGCTATCTCGAAACTCGCCGTTTGGCGCCTTTGTGCGCAGATGCCGGCTCGAGTTCCAGCGACTTGCC
TTTCACGTCTGCACAGAGCTCTGGAAAGACTTTGTGCGCTATCGTCAGACTACGGCCGCCTACCTGCGTCGCAAG
AACCCGTCCCTCGGACGTTTGGGCTTCGACAAGGTGCTGCTGCTCGGCGGTCAGGACGACTGGGATCCCGACGGG
ATAGCGGCTCTGGTTGCTGTCGCGTACGGGGATATGCTTTACGGTGACGAGAGCGGCACCGTGGCTGTGAGCACC
GATGACATCGAGGGTCTTGTCGAGTTTCAGATCGGACGTATGCAGAAGTACGGAAACAGAGTGCCTGTCGAGATA
CGGCTTCAGTTTGAGCATCTGCTTCGCGATAGCTCCCTCGTGCCCAGCGTAAGGCACTATCTCAGCTTCCTCGAC
GCCTGGAGAGCGGGCGACTACACAACGGCCTTTGACGACCTCCATCGATACTTCGACTACACCATGCAGTACCGC
GACCGGCTCTTCTACCAGTACGCCCTCATGAACCTGGCCGTCCTCCAGGCCGACTTCGGCTGCTATCGCGAGGCC
GTCTCGGCCATGCTAGAGACGGTTTCGACGGCCCGCGAGAACCGCGACATGACGTGCCTCAACTTTGCTCTCAAC
TGGCTCTTTCACTTCGGACGCGCCCACCCAAAGCTCGTTCACGACCTCGAGTCCCACAGCATGCTGGGAGCGGGT
AAAGAGAGCCTGGCGTTTCTACGAGTCAAGGCCAAGGAGTCGGGCATGTGGACGCTCTGGAGCTCGGTGCTTCTG
GCCGAGTCCAAGATGGCGCTCGTCAACGGAGACTCGGTGGCGACTTCGGTCGAACACATGGTGCGCAGCTCGCAA
GTCATCGTCGATAAGCGGCTCAAGAACATGTTTGGCTCGCAAATGTCGCTTCAGGCGGCGCTCTGGAGTCGACTC
GGGATAGGACGATTGTCAGCCTGCGCGTCAGAGACGTTCCTGCGCTGCCATGCTCGCAACTCGGTCTTTGAGGAC
GAACTGAAGCACACGTGCCGGCTGGCGTTTGCGCTCGCTCAGCGAGGGAGATATGACGAAGCGTTGCGAAGACTC
GACGGCCTCGATGACGACGACTCGCTCCGTTGGTCATGGAAGCCTAGTCAGTATTGGCTCAAGTACCGAGCCGTC
GTCAAGCTGAAGCGCGACTTGCATCACGGGAACCTGGACGCGGCCCGCCGGCTTCTGGACCAGCTTCTACAGTCC
AAGGCGGACGATCTGGAGCCGGACATGGCCTTTACCGTCGACTCGCTGCACGTCGAATATCTCTCACGCCGGGGC
GACGTCCGGGCAGCGCTGACCGAAGTGGACTCTCTGATGAGCCGTCAAAGGAGCGAGGGCCGGGACGTGGCCGAG
GCCGTCAAACTTCTCCTATCGCGCGTCTCGCTGCTGGACCGCTGTGGAAGGCCGCTGCGAGCGCTTTCGGCGGCG
GTGAGGGCAACGGACATGGCCTGGCGCGCACGGCTTCTCCCGTGCCTGTGGGAAGCGGTGGGCGCTCTGTCATCG
ATGCTGGTGTCTCTGGCCGAGTTCGACGCAGCCGTCAGTCTCCTCACGGCGGTGATCCCACGCTCTCTAGAGTGC
GAGGCCGACGCGCCGGTCGCCCGCCTTTATTCCATCCTGGCAGACGCGCAGATGGGTCTCGCCGGCGCGGCAGAG
GCCCGTTCCAGTCGGCGGACGGAGCTGCTGACGCGGGCGCTTCGGGCGGTCCAGAAGGCGCTGCATCATTACTCG
GTTGTCGAGGACGTGGAGCGCCAGTGCGAGGCCATGGCTAAGAAGGCCATGATCATGAAGCTCACGGGCGAGGCG
GCGCTGGCGGCTGACTATGCCGCTGCCTACGTGGAGTTGCGGAAGAGAGCCGAGGCGCTGAGCCTGGATGGGGCG
TGA
Gene >Ophcf2|06139
ATGGCCCGTTACCTGACGCCAGCCAAGATCGGCCTGCTAGCCCTCATCGAGCTCTACACCGAAGAGTCAGTCCCT
AGCGAGGCGGTGCTCCCGGTGCTGACCTTTATCACGTCGCACATTCTCCACGACGGCAGCGCCTGTGGCTCGCGA
GAGGCGCGATGGGGCAAGGCGGAACGCACAGTCAGCCTCGTCATATCCATCGGCGACTTTGAGAAGCTGCTCAGC
GGCTTTCCCGTGGTGACGGGCATGCCAGGAAGGAAGTTGTGGGATCTTTTCCTCGCTAAGCTGTGGGATGTCGAC
TCTCTAGATGCGCTGCACGCCTTCTTCGAGGCTGTGCCTGCCATGCTAGCAAAGACAAAGGGCGAGAAACAAAGC
GGTGAGGAAGATGAAGAGGAGGAGGAGGAGGAGGAGGAGGAGCAAGAAGAGGAGCAAGATCAGCCGAGCAGCAAG
AAAATCAAGCTATCTCGAAACTCGCCGTTTGGCGCCTTTGTGCGCAGATGCCGGCTCGAGTTCCAGCGACTTGCC
TTTCACGTCTGCACAGAGCTCTGGAAAGACTTTGTGCGCTATCGTCAGACTACGGCCGCCTACCTGCGTCGCAAG
AACCCGTCCCTCGGACGTTTGGGCTTCGACAAGGTGCTGCTGCTCGGCGGTCAGGACGACTGGGATCCCGACGGG
ATAGCGGCTCTGGTTGCTGTCGCGTACGGGGATATGCTTTACGGTGACGAGAGCGGCACCGTGGCTGTGAGCACC
GATGACATCGAGGGTCTTGTCGAGTTTCAGATCGGACGTATGCAGAGTGAGTGGCCAGGTTTGTGGGACTCGGGG
GTTATAGCTCGCTGTTTGCTGACTTGGAGTAAATGAAAGAGTACGGAAACAGAGTGCCTGTCGAGATACGGCTTC
AGTTTGAGCATCTGCTTCGCGATAGCTCCCTCGTGCCCAGCGTAAGGCACTATCTCAGGTTCGTCCTCTTCTGAC
AGCTGCATTCCTTTCCCTCGTCGTCCAAAATCGTGTTCTGCCTGCTGAACTTGTGACGACTCTGATAGCTTCCTC
GACGCCTGGAGAGCGGGCGACTACACAACGGCCTTTGACGACCTCCATCGATACTTCGACTACACCATGCAGTAC
CGCGACCGGCTCTTCTACCAGTACGCCCTCATGAACCTGGCCGTCCTCCAGGCCGACTTCGGCTGCTATCGCGAG
GCCGTCTCGGCCATGCTAGAGACGGTTTCGACGGCCCGCGAGAACCGCGACATGACGTGCCTCAACTTTGCTCTC
AACTGGCTCTTTCACTTCGGACGCGCCCACCCAAAGCTCGTTCACGACCTCGAGTCCCACAGCATGCTGGGAGCG
GGTAAAGAGAGCCTGGCGTTTCTACGAGTCAAGGCCAAGGAGTCGGGCATGTGGACGCTCTGGAGCTCGGTGCTT
CTGGCCGAGTCCAAGATGGCGCTCGTCAACGGAGACTCGGTGGCGACTTCGGTCGAACACATGGTGCGCAGCTCG
CAAGTCATCGTCGATAAGCGGCTCAAGAACATGTTTGGCTCGCAAATGTCGCTTCAGGCGGCGCTCTGGAGTCGA
CTCGGGATAGGACGATTGTCAGCCTGCGCGTCAGAGACGTTCCTGCGCTGCCATGCTCGCAACTCGGTCTTTGAG
GACGAACTGAAGCACACGTGCCGGCTGGCGTTTGCGCTCGCTCAGCGAGGGAGATATGACGAAGCGTTGCGAAGA
CTCGACGGCCTCGATGACGACGACTCGCTCCGTTGGTCATGGAAGCCTAGTCAGTATTGGCTCAAGTACCGAGCC
GTCGTCAAGCTGAAGCGCGACTTGCATCACGGGAACCTGGACGCGGCCCGCCGGCTTCTGGACCAGCTTCTACAG
TCCAAGGCGGACGATCTGGAGCCGGACATGGCCTTTACCGTCGACTCGCTGCACGTCGAATATCTCTCACGCCGG
GGCGACGTCCGGGCAGCGCTGACCGAAGTGGACTCTCTGATGAGCCGTCAAAGGAGCGAGGGCCGGGACGTGGCC
GAGGCCGTCAAACTTCTCCTATCGCGCGTCTCGCTGCTGGACCGCTGTGGAAGGCCGCTGCGAGCGCTTTCGGCG
GCGGTGAGGGCAACGGACATGGCCTGGCGCGCACGGCTTCTCCCGTGCCTGTGGGAAGCGGTGGGCGCTCTGTCA
TCGATGCTGGTGTCTCTGGCCGAGTTCGACGCAGCCGTCAGTCTCCTCACGGCGGTGATCCCACGCTCTCTAGAG
TGCGAGGCCGACGCGCCGGTCGCCCGCCTTTATTCCATCCTGGCAGACGCGCAGATGGGTCTCGCCGGCGCGGCA
GAGGCCCGTTCCAGTCGGCGGACGGAGCTGCTGACGCGGGCGCTTCGGGCGGTCCAGAAGGCGCTGCATCATTAC
TCGGTTGTCGAGGACGTGGAGCGCCAGTGCGAGGCCATGGCTAAGAAGGCCATGATCATGAAGCTCACGGGCGAG
GCGGCGCTGGCGGCTGACTATGCCGCTGCCTACGTGGAGTTGCGGAAGAGAGCCGAGGCGCTGAGCCTGGATGGG
GCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail