Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06126
Gene name
Locationscaffold_07:1330444..1331531
Strand-
Gene length (bp)1087
Transcript length (bp)1026
Coding sequence length (bp)1026
Protein length (aa) 342

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00642 zf-CCCH Zinc finger C-x8-C-x5-C-x3-H type (and similar) 4.1E-08 178 201
PF14634 zf-RING_5 zinc-RING finger domain 1.1E-06 256 293
PF13445 zf-RING_UBOX RING-type zinc-finger 6.0E-06 257 285

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2778 0.9113 0.0479 0.0103 0.0823 0.0103 0.0268 0.0069 0.0168 0.0056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4008
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7274
Ophiocordyceps australis map64 (Brazil) OphauB2|5078
Ophiocordyceps camponoti-floridani Ophcf2|06126 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6728
Ophiocordyceps kimflemingae Ophio5|6357
Ophiocordyceps subramaniannii Hirsu2|8052

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06126
MEKPDSPEKVPVPVAFFKKRSAKSKANLRKRPATPPPADSDSDSDLSSSENEVGQRVKRRKRTALITAASGNPAS
GKGDVAATVFTADRSAPITSTNDATKQSNWYDDDDALPAKKLLGSTRQLPSKRDRAQPDGTYKGLANQTSFIQKN
PDAPTRTVGPIKAPTNIRTITVTDFAPDVCKDYKLTGFCGFGDNCKFLHSREDYKQGWQLDKEWETVTKGKKNLG
GTVVASTRRDKLAHDDEDEDDEALLKGIPFKCHICKGPYREPIVTRCGHYFCESCALKRSGTTCAACGVGTSGLF
KTATGLQKLLARKRERAARRRQEALEAGEEVSEEDEEDEEE*
Coding >Ophcf2|06126
ATGGAAAAGCCCGACAGCCCCGAGAAAGTCCCCGTTCCCGTAGCCTTCTTCAAGAAACGAAGCGCCAAGAGCAAA
GCCAACCTCCGGAAGAGACCCGCGACGCCCCCGCCAGCAGACAGCGACAGCGACAGCGACCTCTCATCATCGGAA
AACGAAGTCGGCCAGCGCGTAAAGCGTCGCAAGCGCACAGCCCTCATCACCGCCGCTTCCGGCAATCCAGCCAGC
GGAAAAGGTGACGTCGCAGCCACAGTCTTCACCGCAGACCGGTCTGCGCCCATCACCAGCACCAACGACGCCACG
AAGCAGAGCAACTGGTACGACGATGATGACGCGCTCCCGGCCAAGAAGCTGCTCGGCTCGACTCGTCAGCTGCCT
TCGAAAAGGGACCGTGCCCAACCCGACGGCACATACAAGGGACTAGCGAACCAGACGTCGTTTATACAGAAGAAT
CCGGACGCGCCGACTCGGACGGTAGGGCCCATCAAAGCTCCGACCAACATCCGCACCATCACCGTGACCGACTTT
GCGCCAGACGTCTGCAAGGACTACAAACTGACGGGGTTCTGCGGCTTCGGCGACAACTGTAAATTCCTACACAGT
CGCGAAGACTACAAACAAGGCTGGCAGCTCGACAAAGAATGGGAGACGGTGACCAAGGGAAAGAAGAACCTAGGC
GGCACCGTCGTAGCCAGCACCCGACGAGACAAGCTAGCGCACGACGACGAAGACGAAGACGACGAGGCCCTCCTC
AAGGGCATACCCTTCAAGTGCCACATCTGCAAGGGCCCCTACCGAGAACCCATCGTGACGAGATGCGGCCACTAC
TTCTGCGAGTCATGCGCTCTGAAGCGCAGCGGCACCACGTGCGCCGCCTGCGGGGTCGGCACCAGCGGCCTTTTC
AAGACGGCGACGGGGCTGCAGAAGCTGCTTGCTCGGAAGAGGGAGCGGGCGGCTAGGCGGCGGCAGGAGGCGCTC
GAGGCTGGCGAGGAGGTCAGCGAGGAGGACGAGGAGGACGAGGAGGAATGA
Transcript >Ophcf2|06126
ATGGAAAAGCCCGACAGCCCCGAGAAAGTCCCCGTTCCCGTAGCCTTCTTCAAGAAACGAAGCGCCAAGAGCAAA
GCCAACCTCCGGAAGAGACCCGCGACGCCCCCGCCAGCAGACAGCGACAGCGACAGCGACCTCTCATCATCGGAA
AACGAAGTCGGCCAGCGCGTAAAGCGTCGCAAGCGCACAGCCCTCATCACCGCCGCTTCCGGCAATCCAGCCAGC
GGAAAAGGTGACGTCGCAGCCACAGTCTTCACCGCAGACCGGTCTGCGCCCATCACCAGCACCAACGACGCCACG
AAGCAGAGCAACTGGTACGACGATGATGACGCGCTCCCGGCCAAGAAGCTGCTCGGCTCGACTCGTCAGCTGCCT
TCGAAAAGGGACCGTGCCCAACCCGACGGCACATACAAGGGACTAGCGAACCAGACGTCGTTTATACAGAAGAAT
CCGGACGCGCCGACTCGGACGGTAGGGCCCATCAAAGCTCCGACCAACATCCGCACCATCACCGTGACCGACTTT
GCGCCAGACGTCTGCAAGGACTACAAACTGACGGGGTTCTGCGGCTTCGGCGACAACTGTAAATTCCTACACAGT
CGCGAAGACTACAAACAAGGCTGGCAGCTCGACAAAGAATGGGAGACGGTGACCAAGGGAAAGAAGAACCTAGGC
GGCACCGTCGTAGCCAGCACCCGACGAGACAAGCTAGCGCACGACGACGAAGACGAAGACGACGAGGCCCTCCTC
AAGGGCATACCCTTCAAGTGCCACATCTGCAAGGGCCCCTACCGAGAACCCATCGTGACGAGATGCGGCCACTAC
TTCTGCGAGTCATGCGCTCTGAAGCGCAGCGGCACCACGTGCGCCGCCTGCGGGGTCGGCACCAGCGGCCTTTTC
AAGACGGCGACGGGGCTGCAGAAGCTGCTTGCTCGGAAGAGGGAGCGGGCGGCTAGGCGGCGGCAGGAGGCGCTC
GAGGCTGGCGAGGAGGTCAGCGAGGAGGACGAGGAGGACGAGGAGGAATGA
Gene >Ophcf2|06126
ATGGAAAAGCCCGACAGCCCCGAGAAAGTCCCCGTTCCCGTAGCCTTCTTCAAGAAACGAAGCGCCAAGAGCAAA
GCCAACCTCCGGAAGAGACCCGCGACGCCCCCGCCAGCAGACAGCGACAGCGACAGCGACCTCTCATCATCGGAA
AACGAAGTCGGCCAGCGCGTAAAGCGTCGCAAGCGCACAGCCCTCATCACCGCCGCTTCCGGCAATCCAGCCAGC
GGAAAAGGTGACGTCGCAGCCACAGTCTTCACCGCAGACCGGTCTGCGCCCATCACCAGCACCAACGACGCCACG
AAGCAGAGCAACTGGTACGACGATGATGACGCGCTCCCGGCCAAGAAGCTGCTCGGCTCGACTCGTCAGCTGCCT
TCGAAAAGGGACCGTGCCCAACCCGACGGCACATACAAGGGACTAGCGAACCAGACGTCGTTTATACAGAAGAAT
CCGGACGCGCCGACTCGGACGGTAGGGCCCATCAAAGCTCCGACCAACATCCGCACCATCACCGTGACCGACTTT
GCGCCAGACGTCTGCAAGGACTACAAACTGACGGGGTTCTGCGGCTTCGGCGACAACTGGTGCGTCTCCTCTGGC
GTAAAACAACGTCTCCTCTCCCCCACGCTAAGATCCCGTCCGCAGTAAATTCCTACACAGTCGCGAAGACTACAA
ACAAGGCTGGCAGCTCGACAAAGAATGGGAGACGGTGACCAAGGGAAAGAAGAACCTAGGCGGCACCGTCGTAGC
CAGCACCCGACGAGACAAGCTAGCGCACGACGACGAAGACGAAGACGACGAGGCCCTCCTCAAGGGCATACCCTT
CAAGTGCCACATCTGCAAGGGCCCCTACCGAGAACCCATCGTGACGAGATGCGGCCACTACTTCTGCGAGTCATG
CGCTCTGAAGCGCAGCGGCACCACGTGCGCCGCCTGCGGGGTCGGCACCAGCGGCCTTTTCAAGACGGCGACGGG
GCTGCAGAAGCTGCTTGCTCGGAAGAGGGAGCGGGCGGCTAGGCGGCGGCAGGAGGCGCTCGAGGCTGGCGAGGA
GGTCAGCGAGGAGGACGAGGAGGACGAGGAGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail