Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06119
Gene name
Locationscaffold_07:1304920..1308644
Strand+
Gene length (bp)3724
Transcript length (bp)3150
Coding sequence length (bp)3150
Protein length (aa) 1050

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03810 IBN_N Importin-beta N-terminal domain 3.4E-12 24 98
PF08506 Cse1 Cse1 5.7E-07 347 449

GO

GO Term Description Terminal node
GO:0031267 small GTPase binding Yes
GO:0006886 intracellular protein transport Yes
GO:0015031 protein transport No
GO:0051234 establishment of localization No
GO:0070727 cellular macromolecule localization No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0033036 macromolecule localization No
GO:0051649 establishment of localization in cell No
GO:0071702 organic substance transport No
GO:0008104 protein localization No
GO:0005488 binding No
GO:0051641 cellular localization No
GO:0003674 molecular_function No
GO:0071705 nitrogen compound transport No
GO:0005515 protein binding No
GO:0045184 establishment of protein localization No
GO:0008150 biological_process No
GO:0046907 intracellular transport No
GO:0051020 GTPase binding No
GO:0019899 enzyme binding No
GO:0051179 localization No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5555 0.7823 0.0089 0.0294 0.0531 0.0039 0.1435 0.0916 0.1395 0.001

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1256
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|754
Ophiocordyceps australis map64 (Brazil) OphauB2|671
Ophiocordyceps camponoti-floridani Ophcf2|06119 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5139
Ophiocordyceps kimflemingae Ophio5|6523
Ophiocordyceps subramaniannii Hirsu2|10477

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06119
MDSAAVRGLLVASLDADADNRRRAELQLKQVEEHTGFIDCLFQILQAEHDASVRLSTVIYIKNRVTRSWFPSDHS
ASEKPISEEEKIRIRDILVPILASSDGPVQQQLVPVLQRILQCDFPTRWPRFIEFTMELINTNNPRSVHAGLQCL
LALCRAFRYKSSDAQDRLQFDSIVETSFSRLVVICNELVTQESDEAGEMLHLALKAFKHATWLELSPYLQQRQVN
IAWCTVFLQTVSKATPANALQGDQFDREKHHWWKAKKWAYFNLNRLFVRHGNPAASSKGAEAAQFANDFATNIAP
EILKHYLQEIEKWVAKTSWLSRPCLSHTLVFLDESVRPKEMWTHLKPHLTNLVTHFVFPVLCLTSDDVEQFEEEP
EEYLHRKLNYFEEASAPDVAATNFLVNLTKNRRKETFEILKFVNAVVNEYEQSADDKKNHIAKEGALRMIGTLAP
VILSKKSPIADQVEYFLVRYVFPDFTSGQGYLRARACDTIEKFEQLNFQDQGNLLTIYRHILDCMADPALPVRVT
ASLALQPLIRHDLIRTSMQQSIPTIMQQLLKLANEVDIDALANVMEDFVEVFAAELTPFAVALCEQLRDTYLRIV
RELLEKESRAGEDGDAYVDYDDKSITALGVLQTIGTLILTLESTPDVLLHIEAVLMPVIKITLENKLYDLYNEVF
EIIDSCTFAAKGISANMWQAFELIHTTFKAGAQYYLEDMLPALDNFVQYGVPQLAQKPQYVEALYSMVGDMFTDT
VQGPVERICACKLSEAMMLSLRGHIDNCVEGFIVMPMNILAGEEVANRSYKIHLMEMVINSIYYNPLLTLQVLEN
KAWTNRFFSLWFGSMPAFSRVHDKKLCIVAISALLSVNHDQVPASVSVGWPRLLQGITELFRTLPSAMKNREEAL
RDDFHLESTHDYGDEDEWGDEDANWNGEEEPAQEEAAETKDESKAYLEFLNDEAQRFSRGVDTGDDDDDLGEDSV
PLESPLDRVEPYQSFKSVMMRMQHEQPQFYASLAGHLSAEDQNMIQTIMNKADEIAASNAQLLAAQQVAQNASS*
Coding >Ophcf2|06119
ATGGACTCCGCTGCTGTCAGGGGCCTGCTGGTTGCCAGCTTGGACGCGGATGCCGATAATAGGCGGAGGGCTGAG
CTTCAGCTGAAGCAGGTGGAAGAGCACACCGGCTTTATCGACTGTCTTTTTCAGATATTACAGGCCGAGCATGAT
GCTAGTGTCCGACTATCGACCGTGATATACATAAAAAACCGTGTCACTCGCTCTTGGTTCCCATCAGATCACAGC
GCCAGCGAGAAACCGATATCCGAGGAAGAAAAAATTCGCATTCGCGACATCCTCGTCCCCATACTGGCATCGTCC
GATGGCCCTGTTCAGCAGCAGCTCGTCCCCGTCCTTCAACGGATCCTCCAATGCGACTTCCCCACTCGCTGGCCG
CGCTTCATCGAGTTCACAATGGAGCTCATCAATACAAACAACCCGCGATCCGTCCACGCAGGCCTTCAATGCTTG
CTCGCCCTCTGCCGCGCATTCCGCTACAAGTCGAGCGACGCCCAAGATAGGCTGCAATTCGACTCAATCGTCGAG
ACGAGCTTCTCCCGTCTCGTCGTCATCTGCAACGAGCTGGTGACGCAGGAGAGTGACGAGGCCGGCGAGATGCTG
CATCTCGCCCTCAAAGCATTCAAACACGCGACATGGCTCGAGCTGTCTCCCTACCTCCAGCAGCGCCAGGTCAAC
ATTGCTTGGTGCACCGTCTTCCTCCAAACTGTCTCCAAGGCGACCCCTGCGAACGCCTTGCAAGGCGATCAGTTC
GACCGAGAGAAGCACCACTGGTGGAAAGCCAAGAAATGGGCCTATTTCAACTTGAACCGCCTCTTTGTCAGGCAC
GGCAACCCGGCAGCCTCAAGCAAGGGTGCCGAGGCCGCCCAGTTCGCCAACGATTTCGCCACTAATATCGCGCCC
GAGATCCTCAAGCACTACCTTCAAGAGATCGAGAAGTGGGTGGCCAAGACGTCTTGGCTCAGCCGGCCTTGCCTC
TCTCATACGCTCGTCTTCCTCGACGAGTCGGTACGACCCAAGGAGATGTGGACTCATCTTAAGCCGCATCTGACC
AATCTCGTCACTCACTTTGTCTTTCCAGTGTTGTGCCTGACGTCAGATGACGTTGAACAGTTCGAGGAAGAGCCA
GAGGAGTATCTCCACCGCAAGCTCAACTACTTCGAAGAGGCCTCGGCCCCGGACGTGGCCGCCACGAATTTCCTC
GTCAACCTGACCAAGAACCGTCGGAAGGAGACGTTTGAGATTCTCAAGTTTGTCAATGCCGTCGTCAACGAGTAC
GAGCAATCGGCCGACGACAAGAAGAATCACATCGCCAAGGAGGGCGCGCTGAGAATGATAGGCACGCTCGCGCCC
GTCATCCTCAGCAAGAAGAGCCCGATCGCCGACCAGGTCGAATACTTCCTGGTGCGCTACGTCTTTCCCGATTTC
ACCAGCGGCCAAGGTTACTTGCGAGCTAGGGCTTGCGACACGATCGAGAAGTTCGAGCAGCTCAACTTCCAAGAC
CAGGGCAATCTTCTGACCATCTACCGGCACATCCTCGACTGCATGGCCGATCCGGCGTTGCCGGTGCGCGTCACG
GCCTCGCTGGCTCTGCAGCCCTTGATCCGGCACGACCTGATACGCACCAGTATGCAGCAGAGCATCCCGACCATC
ATGCAGCAGCTGCTCAAGCTGGCCAACGAGGTCGACATTGACGCGCTGGCCAACGTCATGGAGGACTTTGTCGAG
GTATTCGCGGCGGAGCTCACGCCCTTTGCCGTCGCCCTCTGCGAGCAGCTTCGCGATACCTACCTCCGCATCGTG
CGGGAGCTCCTCGAGAAGGAGAGCCGGGCGGGCGAGGACGGCGACGCCTATGTCGACTACGATGATAAGAGTATC
ACGGCTCTTGGCGTCCTGCAGACGATTGGGACCTTGATCCTCACGCTGGAGAGCACGCCCGACGTTTTGCTCCAC
ATCGAGGCGGTGCTGATGCCGGTCATCAAGATTACTTTGGAGAACAAGCTATACGATCTTTACAACGAGGTTTTC
GAAATCATCGACAGCTGCACCTTTGCCGCCAAGGGCATCTCGGCCAACATGTGGCAGGCCTTTGAGCTGATCCAC
ACGACGTTCAAGGCCGGGGCGCAGTACTACCTCGAAGACATGCTGCCGGCGCTCGACAACTTTGTGCAATACGGC
GTGCCGCAGCTGGCGCAGAAGCCGCAATACGTGGAGGCGCTCTATTCGATGGTGGGCGATATGTTTACGGACACG
GTTCAGGGGCCCGTCGAGCGCATTTGCGCATGCAAGCTATCCGAGGCCATGATGTTAAGCCTTCGGGGCCACATT
GACAACTGCGTTGAGGGCTTCATCGTCATGCCCATGAACATCCTTGCCGGCGAGGAGGTGGCGAACAGGAGCTAC
AAGATTCACTTGATGGAGATGGTCATCAACTCCATCTACTACAACCCCTTGCTGACGCTGCAGGTGCTGGAGAAT
AAGGCTTGGACTAATAGGTTCTTCAGTCTCTGGTTCGGCAGCATGCCTGCCTTCAGCCGGGTCCACGACAAGAAG
TTGTGTATCGTGGCCATATCGGCGCTCCTGAGCGTCAACCACGACCAGGTTCCGGCCAGCGTATCCGTCGGTTGG
CCGCGGCTGCTACAGGGTATCACGGAGTTGTTTCGGACGTTGCCCAGTGCCATGAAGAATCGCGAAGAGGCTCTG
CGCGACGACTTTCACCTCGAATCTACGCATGATTACGGCGACGAGGACGAGTGGGGCGACGAGGACGCCAACTGG
AACGGCGAGGAGGAGCCCGCGCAGGAGGAGGCGGCGGAGACGAAGGATGAGAGCAAGGCCTATCTGGAGTTTCTC
AATGACGAGGCGCAAAGGTTTAGCCGCGGCGTCGACACGGGCGACGACGACGACGACTTGGGCGAAGACAGTGTG
CCGCTGGAGTCACCGCTGGACAGGGTGGAGCCCTATCAGTCATTCAAGTCTGTCATGATGAGGATGCAACACGAG
CAGCCGCAGTTCTACGCGAGCCTGGCGGGCCACTTGTCGGCGGAGGACCAGAACATGATCCAGACCATCATGAAC
AAGGCGGACGAAATCGCGGCCTCGAACGCGCAGCTGTTGGCGGCGCAGCAAGTCGCTCAAAACGCCAGCAGCTAG
Transcript >Ophcf2|06119
ATGGACTCCGCTGCTGTCAGGGGCCTGCTGGTTGCCAGCTTGGACGCGGATGCCGATAATAGGCGGAGGGCTGAG
CTTCAGCTGAAGCAGGTGGAAGAGCACACCGGCTTTATCGACTGTCTTTTTCAGATATTACAGGCCGAGCATGAT
GCTAGTGTCCGACTATCGACCGTGATATACATAAAAAACCGTGTCACTCGCTCTTGGTTCCCATCAGATCACAGC
GCCAGCGAGAAACCGATATCCGAGGAAGAAAAAATTCGCATTCGCGACATCCTCGTCCCCATACTGGCATCGTCC
GATGGCCCTGTTCAGCAGCAGCTCGTCCCCGTCCTTCAACGGATCCTCCAATGCGACTTCCCCACTCGCTGGCCG
CGCTTCATCGAGTTCACAATGGAGCTCATCAATACAAACAACCCGCGATCCGTCCACGCAGGCCTTCAATGCTTG
CTCGCCCTCTGCCGCGCATTCCGCTACAAGTCGAGCGACGCCCAAGATAGGCTGCAATTCGACTCAATCGTCGAG
ACGAGCTTCTCCCGTCTCGTCGTCATCTGCAACGAGCTGGTGACGCAGGAGAGTGACGAGGCCGGCGAGATGCTG
CATCTCGCCCTCAAAGCATTCAAACACGCGACATGGCTCGAGCTGTCTCCCTACCTCCAGCAGCGCCAGGTCAAC
ATTGCTTGGTGCACCGTCTTCCTCCAAACTGTCTCCAAGGCGACCCCTGCGAACGCCTTGCAAGGCGATCAGTTC
GACCGAGAGAAGCACCACTGGTGGAAAGCCAAGAAATGGGCCTATTTCAACTTGAACCGCCTCTTTGTCAGGCAC
GGCAACCCGGCAGCCTCAAGCAAGGGTGCCGAGGCCGCCCAGTTCGCCAACGATTTCGCCACTAATATCGCGCCC
GAGATCCTCAAGCACTACCTTCAAGAGATCGAGAAGTGGGTGGCCAAGACGTCTTGGCTCAGCCGGCCTTGCCTC
TCTCATACGCTCGTCTTCCTCGACGAGTCGGTACGACCCAAGGAGATGTGGACTCATCTTAAGCCGCATCTGACC
AATCTCGTCACTCACTTTGTCTTTCCAGTGTTGTGCCTGACGTCAGATGACGTTGAACAGTTCGAGGAAGAGCCA
GAGGAGTATCTCCACCGCAAGCTCAACTACTTCGAAGAGGCCTCGGCCCCGGACGTGGCCGCCACGAATTTCCTC
GTCAACCTGACCAAGAACCGTCGGAAGGAGACGTTTGAGATTCTCAAGTTTGTCAATGCCGTCGTCAACGAGTAC
GAGCAATCGGCCGACGACAAGAAGAATCACATCGCCAAGGAGGGCGCGCTGAGAATGATAGGCACGCTCGCGCCC
GTCATCCTCAGCAAGAAGAGCCCGATCGCCGACCAGGTCGAATACTTCCTGGTGCGCTACGTCTTTCCCGATTTC
ACCAGCGGCCAAGGTTACTTGCGAGCTAGGGCTTGCGACACGATCGAGAAGTTCGAGCAGCTCAACTTCCAAGAC
CAGGGCAATCTTCTGACCATCTACCGGCACATCCTCGACTGCATGGCCGATCCGGCGTTGCCGGTGCGCGTCACG
GCCTCGCTGGCTCTGCAGCCCTTGATCCGGCACGACCTGATACGCACCAGTATGCAGCAGAGCATCCCGACCATC
ATGCAGCAGCTGCTCAAGCTGGCCAACGAGGTCGACATTGACGCGCTGGCCAACGTCATGGAGGACTTTGTCGAG
GTATTCGCGGCGGAGCTCACGCCCTTTGCCGTCGCCCTCTGCGAGCAGCTTCGCGATACCTACCTCCGCATCGTG
CGGGAGCTCCTCGAGAAGGAGAGCCGGGCGGGCGAGGACGGCGACGCCTATGTCGACTACGATGATAAGAGTATC
ACGGCTCTTGGCGTCCTGCAGACGATTGGGACCTTGATCCTCACGCTGGAGAGCACGCCCGACGTTTTGCTCCAC
ATCGAGGCGGTGCTGATGCCGGTCATCAAGATTACTTTGGAGAACAAGCTATACGATCTTTACAACGAGGTTTTC
GAAATCATCGACAGCTGCACCTTTGCCGCCAAGGGCATCTCGGCCAACATGTGGCAGGCCTTTGAGCTGATCCAC
ACGACGTTCAAGGCCGGGGCGCAGTACTACCTCGAAGACATGCTGCCGGCGCTCGACAACTTTGTGCAATACGGC
GTGCCGCAGCTGGCGCAGAAGCCGCAATACGTGGAGGCGCTCTATTCGATGGTGGGCGATATGTTTACGGACACG
GTTCAGGGGCCCGTCGAGCGCATTTGCGCATGCAAGCTATCCGAGGCCATGATGTTAAGCCTTCGGGGCCACATT
GACAACTGCGTTGAGGGCTTCATCGTCATGCCCATGAACATCCTTGCCGGCGAGGAGGTGGCGAACAGGAGCTAC
AAGATTCACTTGATGGAGATGGTCATCAACTCCATCTACTACAACCCCTTGCTGACGCTGCAGGTGCTGGAGAAT
AAGGCTTGGACTAATAGGTTCTTCAGTCTCTGGTTCGGCAGCATGCCTGCCTTCAGCCGGGTCCACGACAAGAAG
TTGTGTATCGTGGCCATATCGGCGCTCCTGAGCGTCAACCACGACCAGGTTCCGGCCAGCGTATCCGTCGGTTGG
CCGCGGCTGCTACAGGGTATCACGGAGTTGTTTCGGACGTTGCCCAGTGCCATGAAGAATCGCGAAGAGGCTCTG
CGCGACGACTTTCACCTCGAATCTACGCATGATTACGGCGACGAGGACGAGTGGGGCGACGAGGACGCCAACTGG
AACGGCGAGGAGGAGCCCGCGCAGGAGGAGGCGGCGGAGACGAAGGATGAGAGCAAGGCCTATCTGGAGTTTCTC
AATGACGAGGCGCAAAGGTTTAGCCGCGGCGTCGACACGGGCGACGACGACGACGACTTGGGCGAAGACAGTGTG
CCGCTGGAGTCACCGCTGGACAGGGTGGAGCCCTATCAGTCATTCAAGTCTGTCATGATGAGGATGCAACACGAG
CAGCCGCAGTTCTACGCGAGCCTGGCGGGCCACTTGTCGGCGGAGGACCAGAACATGATCCAGACCATCATGAAC
AAGGCGGACGAAATCGCGGCCTCGAACGCGCAGCTGTTGGCGGCGCAGCAAGTCGCTCAAAACGCCAGCAGCTAG
Gene >Ophcf2|06119
ATGGACTCCGCTGCTGTCAGGGGCCTGCTGGTTGCCAGCTTGGACGCGGATGCCGATAATAGGCGGAGGGCTGAG
CTTCAGCTGAAGCAGGTTCGTTTCGTCTGTTCTGCCAGAGCTTGTCGTGGTGGCTGACGTTGCGTCGATATTAGG
TGGAAGAGCACACCGGCTTTATCGACTGTCTTTTTCAGATATTACAGGCCGAGCATGATGCTAGTGTCCGACTAT
CGAGTATGTTCTTCCCGCTACCCGTTTTCGCTGCCCGATTCCCCGATTGTTCCTCTCCCCGTGCCTCTCCTCTTT
CCCTTGGCCGGCTCCTCAGCTCTCTCGTCCGTCTCGCTGCTGACCTGGTCCTTACTAGCCGTGATATACATAAAA
AACCGTGTCACTCGCTCTTGGTTCCCATCAGATCACAGCGCCAGCGAGAAACCGATATCCGAGGAAGAAAAAATT
CGCATTCGCGACATCCTCGTCCCCATACTGGCATCGTCCGATGGCCCTGTTCAGCAGCAGCTCGTCCCCGTCCTT
CAACGGATCCTCCAATGCGACTTCCCCACTCGCTGGCCGCGCTTCATCGAGTTCACAATGGAGCTCATCAATACA
AACAACCCGCGATCCGTCCACGCAGGCCTTCAATGCTTGCTCGCCCTCTGCCGCGCATTCCGCTACAAGTCGAGC
GACGCCCAAGATAGGCTGCAATTCGACTCAATCGTCGAGACGAGCTTCTCCCGTCTCGTCGTCATCTGCAACGAG
CTGGTGACGCAGGAGAGTGACGAGGCCGGCGAGATGCTGCATCTCGCCCTCAAAGCATTCAAACACGCGACATGG
GTACAGTCCACCCCCTTCACCTCTCCCCCCCCTTGTCACCGACTGACACTGACATTCAACGTCACAAAACAGCTC
GAGCTGTCTCCCTACCTCCAGCAGCGCCAGGTCAACATTGCTTGGTGCACCGTCTTCCTCCAAACTGTCTCCAAG
GCGACCCCTGCGAACGCCTTGCAAGGCGATCAGTTCGACCGAGAGAAGCACCACTGGTGGAAAGCCAAGAAATGG
GCCTATTTCAACTTGAACCGCCTCTTTGTCAGGTCCGTCTCCGCCGTCTTCGCATTCTGTTGTTGCCTTGCGCGC
CCTTTGACTGACTCCCGGCTATCGCAGGCACGGCAACCCGGCAGCCTCAAGCAAGGGTGCCGAGGCCGCCCAGTT
CGCCAACGATTTCGCCACTAATATCGCGCCCGAGATCCTCAAGCACTACCTTCAAGAGATCGAGAAGTGGGTGGC
CAAGACGTCTTGGCTCAGCCGGCCTTGCCTCTCTCATACGCTCGTCTTCCTCGACGAGTCGGTACGACCCAAGGA
GATGTGGACTCATCTTAAGCCGCATCTGACCAATCTCGTCACTCACTTTGTCTTTCCAGTGTTGTGCCTGACGTC
AGATGACGTTGAACAGTTCGAGGAAGAGCCAGAGGAGTATCTCCACCGCAAGCTCAACTACTTCGAAGAGGCCTC
GGCCCCGGACGTGGCCGCCACGAATTTCCTCGTCAACCTGACCAAGAACCGTCGGAAGGAGACGTTTGAGATTCT
CAAGTTTGTCAATGCCGTCGTCAACGAGTACGAGCAATCGGCCGACGACAAGAAGAATCACATCGCCAAGGAGGG
CGCGCTGAGAATGATAGGCACGCTCGCGCCCGTCATCCTCAGCAAGAAGAGCCCGATCGCCGACCAGGTCGAATA
CTTCCTGGTGCGCTACGTCTTTCCCGATTTCACCAGCGGCCAAGGTTACTTGCGAGCTAGGGCTTGCGACACGAT
CGAGAAGTTCGAGCAGCTCAACTTCCAAGACCAGGGCAATCTTCTGACCATCTACCGGCACATCCTCGACTGCAT
GGCCGATCCGGCGTTGCCGGTGCGCGTCACGGCCTCGCTGGCTCTGCAGCCCTTGATCCGGCACGACCTGATACG
CACCAGTATGCAGCAGAGCATCCCGACCATCATGCAGCAGCTGCTCAAGCTGGCCAACGAGGTCGACATTGACGC
GCTGGCCAACGTCATGGAGGACTTTGTCGAGGTATTCGCGGCGGAGCTCACGCCCTTTGCCGTCGCCCTCTGCGA
GCAGCTTCGCGATACCTACCTCCGCATCGTGCGGGAGCTCCTCGAGAAGGAGAGCCGGGCGGGCGAGGACGGCGA
CGCCTATGTCGACTACGATGATAAGAGTATCACGGCTCTTGGCGTCCTGCAGACGATTGGGACCTTGATCCTCAC
GCTGGAGAGCACGCCCGACGTTTTGCTCCACATCGAGGCGGTGCTGATGCCGGTCATCAAGATTACTTTGGAGAA
CAAGCTATACGGTCAGTCGTCACACCTGTAGAGCCACGACGCGAGGTTCTGTGTTGCTGACGAGTCGTTCTTCAG
ATCTTTACAACGAGGTTTTCGAAATCATCGACAGCTGCACCTTTGCCGCCAAGGGCATCTCGGCCAACATGTGGC
AGGCCTTTGAGCTGATCCACACGACGTTCAAGGCCGGGGCGCAGTACTACCTCGAAGACATGCTGCCGGCGCTCG
ACAACTTTGTGCAATACGGCGTGCCGCAGCTGGCGCAGAAGCCGCAATACGTGGAGGCGCTCTATTCGATGGTGG
GCGATATGTTTACGGACACGGTTCAGGGGCCCGTCGAGCGCATTTGCGCATGCAAGCTATCCGAGGCCATGATGT
TAAGCCTTCGGGGCCACATTGACAACTGCGTTGAGGGCTTCATCGTCATGCCCATGAACATCCTTGCCGGCGAGG
AGGTGGCGAACAGGAGCTACAAGATTCACTTGATGGAGATGGTCATCAACTCCATCTACTACAACCCCTTGCTGA
CGCTGCAGGTGCTGGAGAATAAGGCTTGGACTAATAGGTTCTTCAGTCTCTGGTTCGGCAGCATGCCTGCCTTCA
GCCGGGTCCACGACAAGAAGTTGTGTATCGTGGCCATATCGGCGCTCCTGAGCGTCAACCACGACCAGGTTCCGG
CCAGCGTATCCGTCGGTTGGCCGCGGCTGCTACAGGGTATCACGGAGTTGTTTCGGACGTTGCCCAGTGCCATGA
AGAGTGCGAACCCCCCCCCCCCCCCCCTTTTTTTTTTCCTTGGATACGAGGGCGAAGGCTGACATGAACTCTCAC
AGATCGCGAAGAGGCTCTGCGCGACGACTTTCACCTCGAATCTACGCATGATTACGGCGACGAGGACGAGTGGGG
CGACGAGGACGCCAACTGGAACGGCGAGGAGGAGCCCGCGCAGGAGGAGGCGGCGGAGACGAAGGATGAGAGCAA
GGCCTATCTGGAGTTTCTCAATGACGAGGTGGGTGAAGACGCCGGAAGCGAGTTGAGATCAACCCCTGCTGACGA
CGACAACAGGCGCAAAGGTTTAGCCGCGGCGTCGACACGGGCGACGACGACGACGACTTGGGCGAAGACAGTGTG
CCGCTGGAGTCACCGCTGGACAGGGTGGAGCCCTATCAGTCATTCAAGTCTGTCATGATGAGTGAGTTTTGTGCT
CTGACGAGTTCGGGGAGATGGCTGACGATCTGCAGGGATGCAACACGAGCAGCCGCAGTTCTACGCGAGCCTGGC
GGGCCACTTGTCGGCGGAGGACCAGAACATGATCCAGACCATCATGAACAAGGCGGACGAAATCGCGGCCTCGAA
CGCGCAGCTGTTGGCGGCGCAGCAAGTCGCTCAAAACGCCAGCAGCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail