Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06116
Gene name
Locationscaffold_07:1287847..1289328
Strand-
Gene length (bp)1481
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 1.1E-11 13 199
PF05462 Dicty_CAR Slime mold cyclic AMP receptor 6.0E-12 18 182
PF00001 7tm_1 7 transmembrane receptor (rhodopsin family) 7.7E-09 28 366
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 1.3E-06 15 187

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0016021 integral component of membrane Yes
GO:0004930 G protein-coupled receptor activity Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0060089 molecular transducer activity No
GO:0038023 signaling receptor activity No
GO:0007165 signal transduction No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0004888 transmembrane signaling receptor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 47 69 22
3 84 106 22
4 118 140 22
5 164 186 22
6 311 333 22
7 353 375 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 0.02 0.00 0.13
Alive In ants, during behavior modification 16.42 7.17 25.68
Dead In ants, recently dead 6.29 2.07 10.51

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.210123 no
Alive Dead 0.000238 yes
Dead Fungus 0.210123 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06116
MHELTLEQRHAISVIERACSVLSLLGCIFTIVTFCSSRAFHKPINRLVFYASFGNMLTNVGTLMSNAYLGELDSF
GCQFQSFLIQTFMPADAFWTLAMAINVYLTFYHKFDAERLRKMEIVYLLGCYGVPLIPAFTYIFVRNSHGQRIYG
NATLWCWISSEYDVLRIATFYGPVWVTILITFFIYIRAGRTIYEKRKQLYEFQTSDPDPLSINGEVVATIKRTEV
TVTEEDASPSGAIHLAPLSSKKKVSDKASSASDGAYSVQISADHCPSPSLDVDSPGNTVQQTTMVQVAPQRPLNP
ARRRHHELNNAAWSYTKCAILFFTAILITWIPSSANRVYSVVHQTEVFPPLEFMSAFVLPLQGLWNAVIYAVTSW
SACQKLFNDLMPLRYRKPVAKIASPDPALAEQGLAARKGGQFRSPPRSSHTFDSESMTELAKSHRTASADEYHAC
*
Coding >Ophcf2|06116
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAGCGCGCCTGTTCCGTTCTCTCTCTGTTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGCGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCCTTTGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTACCTCGGCGAGCTCGACTCGTTC
GGCTGCCAGTTTCAATCCTTCTTGATTCAAACCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATC
AACGTCTATCTCACCTTTTACCACAAATTTGACGCCGAGAGGCTCCGCAAGATGGAAATCGTCTATCTTCTCGGC
TGCTATGGCGTCCCTCTTATACCGGCTTTTACCTACATCTTCGTCCGGAACTCGCACGGGCAGCGTATTTACGGC
AATGCCACGCTTTGGTGCTGGATCTCGAGCGAGTACGACGTGCTACGTATCGCCACTTTCTACGGACCCGTCTGG
GTCACCATCCTCATCACCTTCTTCATCTATATTCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTCTAC
GAGTTCCAAACGTCAGATCCAGACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTC
ACGGTGACGGAAGAGGACGCCTCACCTTCCGGAGCCATTCATCTCGCCCCCCTGAGCAGCAAGAAAAAGGTCTCG
GACAAAGCTTCGTCCGCCTCTGACGGCGCCTACTCAGTCCAAATCTCGGCCGATCACTGCCCATCGCCGTCTCTG
GACGTGGATTCGCCCGGCAACACGGTACAACAGACGACCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAATCCG
GCTCGACGACGCCATCACGAGCTGAACAACGCGGCCTGGTCTTATACCAAGTGCGCCATTCTCTTCTTCACCGCC
ATCCTCATCACTTGGATTCCCTCGAGCGCCAATCGCGTCTACTCGGTCGTTCATCAAACCGAAGTCTTCCCGCCC
CTCGAGTTCATGAGCGCCTTCGTCCTGCCTCTTCAGGGGCTATGGAACGCCGTCATCTACGCCGTCACCTCTTGG
AGTGCCTGTCAGAAGCTCTTCAACGATCTGATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAGCGTCTCCG
GATCCTGCTCTCGCTGAACAAGGTCTCGCTGCCCGCAAGGGAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCAT
ACGTTTGACTCGGAGAGCATGACGGAACTGGCCAAGTCTCATCGAACCGCCTCGGCAGACGAATATCATGCTTGT
TGA
Transcript >Ophcf2|06116
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAGCGCGCCTGTTCCGTTCTCTCTCTGTTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGCGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCCTTTGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTACCTCGGCGAGCTCGACTCGTTC
GGCTGCCAGTTTCAATCCTTCTTGATTCAAACCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATC
AACGTCTATCTCACCTTTTACCACAAATTTGACGCCGAGAGGCTCCGCAAGATGGAAATCGTCTATCTTCTCGGC
TGCTATGGCGTCCCTCTTATACCGGCTTTTACCTACATCTTCGTCCGGAACTCGCACGGGCAGCGTATTTACGGC
AATGCCACGCTTTGGTGCTGGATCTCGAGCGAGTACGACGTGCTACGTATCGCCACTTTCTACGGACCCGTCTGG
GTCACCATCCTCATCACCTTCTTCATCTATATTCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTCTAC
GAGTTCCAAACGTCAGATCCAGACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTC
ACGGTGACGGAAGAGGACGCCTCACCTTCCGGAGCCATTCATCTCGCCCCCCTGAGCAGCAAGAAAAAGGTCTCG
GACAAAGCTTCGTCCGCCTCTGACGGCGCCTACTCAGTCCAAATCTCGGCCGATCACTGCCCATCGCCGTCTCTG
GACGTGGATTCGCCCGGCAACACGGTACAACAGACGACCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAATCCG
GCTCGACGACGCCATCACGAGCTGAACAACGCGGCCTGGTCTTATACCAAGTGCGCCATTCTCTTCTTCACCGCC
ATCCTCATCACTTGGATTCCCTCGAGCGCCAATCGCGTCTACTCGGTCGTTCATCAAACCGAAGTCTTCCCGCCC
CTCGAGTTCATGAGCGCCTTCGTCCTGCCTCTTCAGGGGCTATGGAACGCCGTCATCTACGCCGTCACCTCTTGG
AGTGCCTGTCAGAAGCTCTTCAACGATCTGATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAGCGTCTCCG
GATCCTGCTCTCGCTGAACAAGGTCTCGCTGCCCGCAAGGGAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCAT
ACGTTTGACTCGGAGAGCATGACGGAACTGGCCAAGTCTCATCGAACCGCCTCGGCAGACGAATATCATGCTTGT
TGA
Gene >Ophcf2|06116
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAGCGCGCCTGTTCCGTTCTCTCTCTGTTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGCGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCCTTTGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTACCTCGGCGAGCTCGACTCGTTC
GGCTGCCAGTTTCAATCCTTCTTGATTCAAACGTTGGTCATCTCTTATCTTATATCTCTTCGTTTCCGCAGTCGT
TGAACTGACCCCCTTTCTGCCGCCAGCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATCAACGTC
TATCTCACCTTTTACCACAAATTTGACGCCGAGAGGCTCCGCAAGATGGAAATCGTCTATCTTCTCGGCTGCTAT
GGCGTCCCTCTTATACCGGCTTTTACCTACATCTTCGTCCGGAACTCGCACGGGCAGCGTATTTACGGCAATGCC
ACGCTTTGGTGCTGGATCTCGAGCGAGTACGACGTGCTACGTATCGCCACTTTCTACGGACCCGTCTGGTGAGCA
TACCATGTCTGTCTTGCTTGTGTCGAGTAGTCAAATGGCTAACCTTGATCAGGGTCACCATCCTCATCACCTTCT
TCATCTATATTCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTCTACGAGTTCCAAACGTCAGATCCAG
ACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTCACGGTGACGGAAGAGGACGCCT
CACCTTCCGGAGCCATTCATCTCGCCCCCCTGAGCAGCAAGAAAAAGGTCTCGGACAAAGCTTCGTCCGCCTCTG
ACGGCGCCTACTCAGTCCAAATCTCGGCCGATCACTGCCCATCGCCGTCTCTGGACGTGGATTCGCCCGGCAACA
CGGTACAACAGACGACCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAATCCGGCTCGACGACGCCATCACGAGC
TGAACAACGCGGCCTGGTCTTATACCAAGTGCGCCATTCTCTTCTTCACCGCCATCCTCATCACTTGGATTCCCT
CGAGCGCCAATCGCGTCTACTCGGTCGTTCATCAAACCGAAGTCTTCCCGCCCCTCGAGTTCATGAGCGCCTTCG
TCCTGCCTCTTCAGGGGCTATGGAACGCCGTCATCTACGCCGTCACCTCTTGGAGTGCCTGTCAGAAGCTCTTCA
ACGATCTGATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAGCGTCTCCGGATCCTGCTCTCGCTGAACAAG
GTCTCGCTGCCCGCAAGGGAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCATACGTTTGACTCGGAGAGCATGA
CGGAACTGGCCAAGTCTCATCGAACCGCCTCGGCAGACGAATATCATGCTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail