Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06116
Gene name
Locationscaffold_07:1287847..1289328
Strand-
Gene length (bp)1481
Transcript length (bp)1353
Coding sequence length (bp)1353
Protein length (aa) 451

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00002 7tm_2 7 transmembrane receptor (Secretin family) 1.1E-11 13 199
PF05462 Dicty_CAR Slime mold cyclic AMP receptor 6.0E-12 18 182
PF00001 7tm_1 7 transmembrane receptor (rhodopsin family) 7.7E-09 28 366
PF11710 Git3 G protein-coupled glucose receptor regulating Gpa2 1.3E-06 15 187

GO

GO Term Description Terminal node
GO:0007186 G protein-coupled receptor signaling pathway Yes
GO:0016021 integral component of membrane Yes
GO:0004930 G protein-coupled receptor activity Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0060089 molecular transducer activity No
GO:0038023 signaling receptor activity No
GO:0007165 signal transduction No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0050789 regulation of biological process No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0050794 regulation of cellular process No
GO:0065007 biological regulation No
GO:0004888 transmembrane signaling receptor activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 38 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22
2 47 69 22
3 84 106 22
4 118 140 22
5 164 186 22
6 311 333 22
7 353 375 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06116
MHELTLEQRHAISVIERACSVLSLLGCIFTIVTFCSSRAFHKPINRLVFYASFGNMLTNVGTLMSNAYLGELDSF
GCQFQSFLIQTFMPADAFWTLAMAINVYLTFYHKFDAERLRKMEIVYLLGCYGVPLIPAFTYIFVRNSHGQRIYG
NATLWCWISSEYDVLRIATFYGPVWVTILITFFIYIRAGRTIYEKRKQLYEFQTSDPDPLSINGEVVATIKRTEV
TVTEEDASPSGAIHLAPLSSKKKVSDKASSASDGAYSVQISADHCPSPSLDVDSPGNTVQQTTMVQVAPQRPLNP
ARRRHHELNNAAWSYTKCAILFFTAILITWIPSSANRVYSVVHQTEVFPPLEFMSAFVLPLQGLWNAVIYAVTSW
SACQKLFNDLMPLRYRKPVAKIASPDPALAEQGLAARKGGQFRSPPRSSHTFDSESMTELAKSHRTASADEYHAC
*
Coding >Ophcf2|06116
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAGCGCGCCTGTTCCGTTCTCTCTCTGTTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGCGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCCTTTGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTACCTCGGCGAGCTCGACTCGTTC
GGCTGCCAGTTTCAATCCTTCTTGATTCAAACCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATC
AACGTCTATCTCACCTTTTACCACAAATTTGACGCCGAGAGGCTCCGCAAGATGGAAATCGTCTATCTTCTCGGC
TGCTATGGCGTCCCTCTTATACCGGCTTTTACCTACATCTTCGTCCGGAACTCGCACGGGCAGCGTATTTACGGC
AATGCCACGCTTTGGTGCTGGATCTCGAGCGAGTACGACGTGCTACGTATCGCCACTTTCTACGGACCCGTCTGG
GTCACCATCCTCATCACCTTCTTCATCTATATTCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTCTAC
GAGTTCCAAACGTCAGATCCAGACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTC
ACGGTGACGGAAGAGGACGCCTCACCTTCCGGAGCCATTCATCTCGCCCCCCTGAGCAGCAAGAAAAAGGTCTCG
GACAAAGCTTCGTCCGCCTCTGACGGCGCCTACTCAGTCCAAATCTCGGCCGATCACTGCCCATCGCCGTCTCTG
GACGTGGATTCGCCCGGCAACACGGTACAACAGACGACCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAATCCG
GCTCGACGACGCCATCACGAGCTGAACAACGCGGCCTGGTCTTATACCAAGTGCGCCATTCTCTTCTTCACCGCC
ATCCTCATCACTTGGATTCCCTCGAGCGCCAATCGCGTCTACTCGGTCGTTCATCAAACCGAAGTCTTCCCGCCC
CTCGAGTTCATGAGCGCCTTCGTCCTGCCTCTTCAGGGGCTATGGAACGCCGTCATCTACGCCGTCACCTCTTGG
AGTGCCTGTCAGAAGCTCTTCAACGATCTGATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAGCGTCTCCG
GATCCTGCTCTCGCTGAACAAGGTCTCGCTGCCCGCAAGGGAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCAT
ACGTTTGACTCGGAGAGCATGACGGAACTGGCCAAGTCTCATCGAACCGCCTCGGCAGACGAATATCATGCTTGT
TGA
Transcript >Ophcf2|06116
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAGCGCGCCTGTTCCGTTCTCTCTCTGTTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGCGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCCTTTGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTACCTCGGCGAGCTCGACTCGTTC
GGCTGCCAGTTTCAATCCTTCTTGATTCAAACCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATC
AACGTCTATCTCACCTTTTACCACAAATTTGACGCCGAGAGGCTCCGCAAGATGGAAATCGTCTATCTTCTCGGC
TGCTATGGCGTCCCTCTTATACCGGCTTTTACCTACATCTTCGTCCGGAACTCGCACGGGCAGCGTATTTACGGC
AATGCCACGCTTTGGTGCTGGATCTCGAGCGAGTACGACGTGCTACGTATCGCCACTTTCTACGGACCCGTCTGG
GTCACCATCCTCATCACCTTCTTCATCTATATTCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTCTAC
GAGTTCCAAACGTCAGATCCAGACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTC
ACGGTGACGGAAGAGGACGCCTCACCTTCCGGAGCCATTCATCTCGCCCCCCTGAGCAGCAAGAAAAAGGTCTCG
GACAAAGCTTCGTCCGCCTCTGACGGCGCCTACTCAGTCCAAATCTCGGCCGATCACTGCCCATCGCCGTCTCTG
GACGTGGATTCGCCCGGCAACACGGTACAACAGACGACCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAATCCG
GCTCGACGACGCCATCACGAGCTGAACAACGCGGCCTGGTCTTATACCAAGTGCGCCATTCTCTTCTTCACCGCC
ATCCTCATCACTTGGATTCCCTCGAGCGCCAATCGCGTCTACTCGGTCGTTCATCAAACCGAAGTCTTCCCGCCC
CTCGAGTTCATGAGCGCCTTCGTCCTGCCTCTTCAGGGGCTATGGAACGCCGTCATCTACGCCGTCACCTCTTGG
AGTGCCTGTCAGAAGCTCTTCAACGATCTGATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAGCGTCTCCG
GATCCTGCTCTCGCTGAACAAGGTCTCGCTGCCCGCAAGGGAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCAT
ACGTTTGACTCGGAGAGCATGACGGAACTGGCCAAGTCTCATCGAACCGCCTCGGCAGACGAATATCATGCTTGT
TGA
Gene >Ophcf2|06116
ATGCACGAGTTGACGCTCGAGCAGCGTCACGCCATCAGCGTCATCGAGCGCGCCTGTTCCGTTCTCTCTCTGTTG
GGATGCATCTTCACCATCGTCACCTTTTGCTCTTCCCGCGCCTTCCACAAGCCCATCAACCGGCTGGTGTTTTAC
GCCTCCTTTGGTAACATGTTGACCAACGTCGGCACTCTCATGTCCAATGCCTACCTCGGCGAGCTCGACTCGTTC
GGCTGCCAGTTTCAATCCTTCTTGATTCAAACGTTGGTCATCTCTTATCTTATATCTCTTCGTTTCCGCAGTCGT
TGAACTGACCCCCTTTCTGCCGCCAGCTTCATGCCTGCCGACGCCTTCTGGACTCTGGCCATGGCCATCAACGTC
TATCTCACCTTTTACCACAAATTTGACGCCGAGAGGCTCCGCAAGATGGAAATCGTCTATCTTCTCGGCTGCTAT
GGCGTCCCTCTTATACCGGCTTTTACCTACATCTTCGTCCGGAACTCGCACGGGCAGCGTATTTACGGCAATGCC
ACGCTTTGGTGCTGGATCTCGAGCGAGTACGACGTGCTACGTATCGCCACTTTCTACGGACCCGTCTGGTGAGCA
TACCATGTCTGTCTTGCTTGTGTCGAGTAGTCAAATGGCTAACCTTGATCAGGGTCACCATCCTCATCACCTTCT
TCATCTATATTCGAGCCGGACGCACCATCTACGAGAAACGCAAGCAGCTCTACGAGTTCCAAACGTCAGATCCAG
ACCCCCTATCCATCAACGGCGAGGTCGTGGCCACCATCAAGCGGACAGAAGTCACGGTGACGGAAGAGGACGCCT
CACCTTCCGGAGCCATTCATCTCGCCCCCCTGAGCAGCAAGAAAAAGGTCTCGGACAAAGCTTCGTCCGCCTCTG
ACGGCGCCTACTCAGTCCAAATCTCGGCCGATCACTGCCCATCGCCGTCTCTGGACGTGGATTCGCCCGGCAACA
CGGTACAACAGACGACCATGGTCCAGGTGGCGCCTCAGCGGCCGCTTAATCCGGCTCGACGACGCCATCACGAGC
TGAACAACGCGGCCTGGTCTTATACCAAGTGCGCCATTCTCTTCTTCACCGCCATCCTCATCACTTGGATTCCCT
CGAGCGCCAATCGCGTCTACTCGGTCGTTCATCAAACCGAAGTCTTCCCGCCCCTCGAGTTCATGAGCGCCTTCG
TCCTGCCTCTTCAGGGGCTATGGAACGCCGTCATCTACGCCGTCACCTCTTGGAGTGCCTGTCAGAAGCTCTTCA
ACGATCTGATGCCCCTTCGTTACCGCAAGCCCGTCGCCAAAATAGCGTCTCCGGATCCTGCTCTCGCTGAACAAG
GTCTCGCTGCCCGCAAGGGAGGCCAGTTCCGCTCGCCGCCTCGCAGCTCGCATACGTTTGACTCGGAGAGCATGA
CGGAACTGGCCAAGTCTCATCGAACCGCCTCGGCAGACGAATATCATGCTTGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail