Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06114
Gene name
Locationscaffold_07:1279209..1280705
Strand-
Gene length (bp)1496
Transcript length (bp)1338
Coding sequence length (bp)1338
Protein length (aa) 446

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00860 Xan_ur_permease Permease family 2.6E-08 10 78
PF00860 Xan_ur_permease Permease family 2.8E-14 101 351

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0003674 molecular_function No
GO:0005215 transporter activity No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.5

Transmembrane Domains

Domain # Start End Length
1 20 42 22
2 62 84 22
3 118 135 17
4 140 159 19
5 202 224 22
6 245 267 22
7 282 304 22
8 325 347 22
9 352 374 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06114
MGLNAYFAFQVVGVNGSGNISYRTALTAVFFEGLIFVVLALTGLRQWLVRLIPATIKTATGVGIGLFLTEIGLSY
SVGIGAITGGGRATPLALGGCPLELIDQQSGMCQSGQMTSPKMWTGVIGGGIVTSFLMAFRVKYAFVIGIAIVSV
VSWPRHTSISYFPDTVEGNARFAFFQQVVAWHPIRHVANSLDWAFTAGGSHFALALFTFLYVDIIDATATLYSMA
RFCGVADRRDGDFPRSTLAYCTDAVFISVGALLGSSPVTVFIESGAGIAEGGRTGLTAIVAGLCFVASIFFAPIF
ASIPPWATGCTLVLVGCMMMRQITLINWNYFGDVLPSFVVIAFIPFSYSVAYGLIAGLFVYAVLNGLVGLVVLLS
GGRFEPREYELKEYWTWKGGGRPPWFVRAINAHRRRRDAVRELETDDGRGSSLRDSRADSAPKEFPVPAT*
Coding >Ophcf2|06114
ATGGGCCTCAACGCCTACTTCGCCTTCCAAGTCGTCGGCGTCAACGGCTCGGGCAACATCTCGTACCGCACCGCC
CTCACCGCCGTCTTCTTTGAAGGCCTCATCTTCGTCGTCCTCGCCCTCACCGGTCTCCGCCAGTGGCTCGTCCGC
CTCATTCCCGCGACCATCAAGACAGCCACCGGCGTTGGCATCGGTCTCTTCCTCACTGAAATAGGCCTCTCGTAC
TCGGTCGGTATCGGCGCCATCACTGGAGGTGGAAGAGCTACTCCTCTCGCTCTCGGCGGCTGTCCGCTCGAACTC
ATCGATCAGCAGTCCGGCATGTGTCAGTCCGGCCAGATGACGAGCCCCAAGATGTGGACGGGCGTCATCGGCGGA
GGCATCGTCACCTCGTTCCTCATGGCCTTTCGCGTCAAGTACGCGTTCGTCATTGGCATCGCCATCGTTTCCGTC
GTCTCCTGGCCCCGCCACACCTCCATCTCCTACTTCCCCGACACAGTTGAGGGCAACGCCCGCTTCGCCTTCTTC
CAGCAAGTCGTAGCCTGGCATCCCATCCGCCACGTCGCCAACAGCCTTGACTGGGCCTTCACAGCCGGAGGCTCA
CACTTTGCCCTCGCCCTCTTCACCTTTCTATACGTCGACATCATCGACGCCACCGCAACGCTCTACTCCATGGCC
CGCTTCTGCGGCGTCGCCGACCGTCGTGACGGCGACTTTCCGCGCTCCACGCTCGCGTATTGCACCGACGCCGTC
TTCATCTCCGTTGGCGCTCTGCTCGGCTCCTCGCCCGTCACCGTTTTTATTGAGAGCGGTGCAGGTATTGCTGAG
GGTGGACGGACCGGGTTGACGGCTATTGTTGCCGGTTTGTGCTTTGTTGCCTCCATCTTCTTCGCCCCGATCTTT
GCCTCGATTCCGCCCTGGGCTACGGGTTGTACCTTGGTTCTGGTCGGCTGCATGATGATGCGTCAAATCACCCTC
ATCAACTGGAACTACTTCGGCGACGTCCTCCCCTCCTTTGTTGTCATCGCCTTTATCCCCTTCAGCTATAGCGTC
GCCTACGGCCTCATCGCCGGCCTCTTCGTCTACGCCGTCCTCAACGGCCTCGTCGGTCTCGTCGTCCTCCTCAGC
GGCGGCCGATTCGAGCCCCGTGAGTACGAGTTGAAAGAGTACTGGACCTGGAAAGGCGGAGGCCGTCCACCCTGG
TTCGTCAGGGCCATCAACGCCCATCGTCGTCGCAGGGACGCCGTTCGTGAGCTCGAGACGGATGACGGCCGCGGG
TCTTCGCTTCGTGACTCCCGCGCGGATTCTGCGCCTAAGGAGTTCCCCGTACCCGCTACGTGA
Transcript >Ophcf2|06114
ATGGGCCTCAACGCCTACTTCGCCTTCCAAGTCGTCGGCGTCAACGGCTCGGGCAACATCTCGTACCGCACCGCC
CTCACCGCCGTCTTCTTTGAAGGCCTCATCTTCGTCGTCCTCGCCCTCACCGGTCTCCGCCAGTGGCTCGTCCGC
CTCATTCCCGCGACCATCAAGACAGCCACCGGCGTTGGCATCGGTCTCTTCCTCACTGAAATAGGCCTCTCGTAC
TCGGTCGGTATCGGCGCCATCACTGGAGGTGGAAGAGCTACTCCTCTCGCTCTCGGCGGCTGTCCGCTCGAACTC
ATCGATCAGCAGTCCGGCATGTGTCAGTCCGGCCAGATGACGAGCCCCAAGATGTGGACGGGCGTCATCGGCGGA
GGCATCGTCACCTCGTTCCTCATGGCCTTTCGCGTCAAGTACGCGTTCGTCATTGGCATCGCCATCGTTTCCGTC
GTCTCCTGGCCCCGCCACACCTCCATCTCCTACTTCCCCGACACAGTTGAGGGCAACGCCCGCTTCGCCTTCTTC
CAGCAAGTCGTAGCCTGGCATCCCATCCGCCACGTCGCCAACAGCCTTGACTGGGCCTTCACAGCCGGAGGCTCA
CACTTTGCCCTCGCCCTCTTCACCTTTCTATACGTCGACATCATCGACGCCACCGCAACGCTCTACTCCATGGCC
CGCTTCTGCGGCGTCGCCGACCGTCGTGACGGCGACTTTCCGCGCTCCACGCTCGCGTATTGCACCGACGCCGTC
TTCATCTCCGTTGGCGCTCTGCTCGGCTCCTCGCCCGTCACCGTTTTTATTGAGAGCGGTGCAGGTATTGCTGAG
GGTGGACGGACCGGGTTGACGGCTATTGTTGCCGGTTTGTGCTTTGTTGCCTCCATCTTCTTCGCCCCGATCTTT
GCCTCGATTCCGCCCTGGGCTACGGGTTGTACCTTGGTTCTGGTCGGCTGCATGATGATGCGTCAAATCACCCTC
ATCAACTGGAACTACTTCGGCGACGTCCTCCCCTCCTTTGTTGTCATCGCCTTTATCCCCTTCAGCTATAGCGTC
GCCTACGGCCTCATCGCCGGCCTCTTCGTCTACGCCGTCCTCAACGGCCTCGTCGGTCTCGTCGTCCTCCTCAGC
GGCGGCCGATTCGAGCCCCGTGAGTACGAGTTGAAAGAGTACTGGACCTGGAAAGGCGGAGGCCGTCCACCCTGG
TTCGTCAGGGCCATCAACGCCCATCGTCGTCGCAGGGACGCCGTTCGTGAGCTCGAGACGGATGACGGCCGCGGG
TCTTCGCTTCGTGACTCCCGCGCGGATTCTGCGCCTAAGGAGTTCCCCGTACCCGCTACGTGA
Gene >Ophcf2|06114
ATGGGCCTCAACGCCTACTTCGCCTTCCAAGTCGTCGGCGTCAACGGCTCGGGCAACATCTCGTACCGCACCGCC
CTCACCGCCGTCTTCTTTGAAGGCCTCATCTTCGTCGTCCTCGCCCTCACCGGTCTCCGCCAGTGGCTCGTCCGC
CTCATTCCCGCGACCATCAAGACAGCCACCGGCGTTGGCATCGGTCTCTTCCTCACTGAAATAGGCCTCTCGTAC
TCGGTCGGTATCGGCGCCATCACTGGAGGTGGAAGAGCTACTCCTCTCGCTCTCGGCGGCTGTCCGCTCGAACTC
ATCGATCAGCAGTCCGGCATGTGTCAGTCCGGCCAGATGACGAGCCCCAAGATGTGGACGGGCGTCATCGGCGGA
GGCATCGTCACCTCGTTCCTCATGGCCTTTCGCGTCAAGTACGCGTTCGTCATTGGCATCGCCATCGTTTCCGTC
GTCTCCTGGCCGTGAGTCACGTCCCATGGCGCTCCTCTTACACTCCCTCCCCTGACTCCCTCGTCATATAGCCGC
CACACCTCCATCTCCTACTTCCCCGACACAGTTGAGGGCAACGCCCGCTTCGCCTTCTTCCAGCAAGTCGTAGCC
TGGCATCCCATCCGCCACGTCGCCAACAGCCTTGACTGGGCCTTCACAGCCGGAGGCTCACACTTTGCCCTCGCC
CTCTTCACCTTTCTATACGTCGACATCATCGACGCCACCGCAACGCTCTACTCCATGGCCCGCTTCTGCGGCGTC
GCCGACCGTCGTGACGGCGACTTTCCGCGCTCCACGCTCGCGTATTGCACCGACGCCGTCTTCATCTCCGTTGGC
GCTCTGCTCGGCTCCTCGCCCGTCACCGTTTTTATTGAGAGCGGTGCAGGTATTGCTGAGGGTGGACGGACCGGG
TTGACGGCTATTGTTGCCGGTTTGTGCTTTGTTGCCTCCATCTTCTTCGCCCCGATCTTTGCCTCGATTCCGCCC
TGGGCTACGGGTTGTACCTTGGTTCTGGTAAGTCTCTCCTCGCTACCCCCAATGCAATGAAGACTAACACGATGC
AAGGTCGGCTGCATGATGATGCGTCAAATCACCCTCATCAACTGGAACTACTTCGGCGACGTCCTCCCCTCCTTT
GTTGTCATCGCCTTTATCCCCTTCAGCTATAGCGTCGCCTACGGCCTCATCGCGTCTGTCCCCCCCCCCCTCCTA
TCGCTCAATTTCTAACACCCCAAAGCGGCCTCTTCGTCTACGCCGTCCTCAACGGCCTCGTCGGTCTCGTCGTCC
TCCTCAGCGGCGGCCGATTCGAGCCCCGTGAGTACGAGTTGAAAGAGTACTGGACCTGGAAAGGCGGAGGCCGTC
CACCCTGGTTCGTCAGGGCCATCAACGCCCATCGTCGTCGCAGGGACGCCGTTCGTGAGCTCGAGACGGATGACG
GCCGCGGGTCTTCGCTTCGTGACTCCCGCGCGGATTCTGCGCCTAAGGAGTTCCCCGTACCCGCTACGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail