Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06109
Gene name
Locationscaffold_07:1269620..1270181
Strand+
Gene length (bp)561
Transcript length (bp)561
Coding sequence length (bp)561
Protein length (aa) 187

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00881 Nitroreductase Nitroreductase family 6.0E-15 16 183

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7422 0.5226 0.0122 0.0188 0.465 0.4965 0.0541 0.2626 0.1467 0.5374

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup477
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1120
Ophiocordyceps australis 1348a (Ghana) OphauG2|2166
Ophiocordyceps australis map64 (Brazil) OphauB2|1593
Ophiocordyceps australis map64 (Brazil) OphauB2|659
Ophiocordyceps camponoti-floridani Ophcf2|06109 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5974
Ophiocordyceps kimflemingae Ophio5|268
Ophiocordyceps subramaniannii Hirsu2|10584

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06109
MATQKISSDLLLQLARNRRTVYQLNKTLSIPTSRIRNLVQETTLHTPSSFNSQTTRAVLLLGKAHDRLWALTSDT
LRAVVPADRWPASEQRLAGFAAAAGTVLFFVDEAAVAKMQEKLPTYADRFPGWAEQSAGMQQWALWTALEADGLG
ANLQHYNPLIDERVGAEWGLSGEWRLNAQLVFGGEG*
Coding >Ophcf2|06109
ATGGCAACCCAGAAGATCTCCTCCGACCTCCTCCTCCAACTAGCCCGCAACCGCCGAACCGTCTACCAGCTCAAC
AAAACGCTCTCGATCCCAACCTCGAGGATCCGCAACCTAGTTCAAGAAACCACGCTCCACACCCCCTCATCCTTC
AACTCGCAAACCACCCGAGCCGTCCTCCTCTTAGGAAAAGCCCACGACCGCCTGTGGGCGCTAACCAGCGACACT
CTCCGCGCCGTCGTACCAGCGGACCGATGGCCCGCGTCCGAGCAGCGGCTGGCGGGCTTCGCGGCGGCGGCCGGA
ACGGTGCTCTTCTTCGTGGACGAGGCGGCCGTCGCGAAGATGCAGGAGAAGCTGCCGACGTACGCGGATCGCTTC
CCCGGATGGGCGGAGCAGAGCGCGGGGATGCAGCAGTGGGCGCTGTGGACGGCGCTTGAGGCGGATGGGCTGGGG
GCTAATCTGCAGCATTATAATCCGCTCATTGATGAGCGTGTTGGGGCAGAGTGGGGGCTGTCGGGCGAGTGGAGG
TTGAATGCTCAGCTTGTTTTTGGGGGGGAGGGTTGA
Transcript >Ophcf2|06109
ATGGCAACCCAGAAGATCTCCTCCGACCTCCTCCTCCAACTAGCCCGCAACCGCCGAACCGTCTACCAGCTCAAC
AAAACGCTCTCGATCCCAACCTCGAGGATCCGCAACCTAGTTCAAGAAACCACGCTCCACACCCCCTCATCCTTC
AACTCGCAAACCACCCGAGCCGTCCTCCTCTTAGGAAAAGCCCACGACCGCCTGTGGGCGCTAACCAGCGACACT
CTCCGCGCCGTCGTACCAGCGGACCGATGGCCCGCGTCCGAGCAGCGGCTGGCGGGCTTCGCGGCGGCGGCCGGA
ACGGTGCTCTTCTTCGTGGACGAGGCGGCCGTCGCGAAGATGCAGGAGAAGCTGCCGACGTACGCGGATCGCTTC
CCCGGATGGGCGGAGCAGAGCGCGGGGATGCAGCAGTGGGCGCTGTGGACGGCGCTTGAGGCGGATGGGCTGGGG
GCTAATCTGCAGCATTATAATCCGCTCATTGATGAGCGTGTTGGGGCAGAGTGGGGGCTGTCGGGCGAGTGGAGG
TTGAATGCTCAGCTTGTTTTTGGGGGGGAGGGTTGA
Gene >Ophcf2|06109
ATGGCAACCCAGAAGATCTCCTCCGACCTCCTCCTCCAACTAGCCCGCAACCGCCGAACCGTCTACCAGCTCAAC
AAAACGCTCTCGATCCCAACCTCGAGGATCCGCAACCTAGTTCAAGAAACCACGCTCCACACCCCCTCATCCTTC
AACTCGCAAACCACCCGAGCCGTCCTCCTCTTAGGAAAAGCCCACGACCGCCTGTGGGCGCTAACCAGCGACACT
CTCCGCGCCGTCGTACCAGCGGACCGATGGCCCGCGTCCGAGCAGCGGCTGGCGGGCTTCGCGGCGGCGGCCGGA
ACGGTGCTCTTCTTCGTGGACGAGGCGGCCGTCGCGAAGATGCAGGAGAAGCTGCCGACGTACGCGGATCGCTTC
CCCGGATGGGCGGAGCAGAGCGCGGGGATGCAGCAGTGGGCGCTGTGGACGGCGCTTGAGGCGGATGGGCTGGGG
GCTAATCTGCAGCATTATAATCCGCTCATTGATGAGCGTGTTGGGGCAGAGTGGGGGCTGTCGGGCGAGTGGAGG
TTGAATGCTCAGCTTGTTTTTGGGGGGGAGGGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail