Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06102
Gene name
Locationscaffold_07:1253610..1255886
Strand+
Gene length (bp)2276
Transcript length (bp)2172
Coding sequence length (bp)2172
Protein length (aa) 724

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08172 CASP_C CASP C terminal 2.1E-91 437 678

GO

GO Term Description Terminal node
GO:0030173 integral component of Golgi membrane Yes
GO:0006891 intra-Golgi vesicle-mediated transport Yes
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0048193 Golgi vesicle transport No
GO:0031228 intrinsic component of Golgi membrane No
GO:0016192 vesicle-mediated transport No
GO:0008150 biological_process No
GO:0031224 intrinsic component of membrane No
GO:0031300 intrinsic component of organelle membrane No
GO:0006810 transport No
GO:0031301 integral component of organelle membrane No
GO:0016021 integral component of membrane No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 656 678 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06102
MAGDAQAPAPAAGAVTEPTSNPAEGGNKFQDAISAWRNVDLTTLTATLDNTASEIVTYQRDSTVQRKDLAQKTKE
FRKLDDASKLVEVKGLLKAYQTFIDLLTTHSKSVNSAFLQTYSSISEAPDPYPLLEAAVDSMLVTEETLPRVTEE
NQRLQETVARLTSQLGEAESMLQVERAARKESEDTLEARVKGVESSWTAVLDEKKDNWEARETSLEEKLENQERL
LSEMRASYEVGQRLGLSGEDADASRGNASSAELEMLHSELEQKGARLAEVEARNEQMRLELARAKSSMSSQPEKS
LEDDPDFMRMRTENSSLIRKLEAARMDKEKLKRDLDTRLHIMEREASQLKEERALLKSKMQKWSDYDNIKQELEV
LKSIEFSTGDDDEGGDKADDGAEKGDTLEILLLSRNKKLSEELTILRVSHRDLDRRLASILEELSGTKEELEKAQ
KLNEKLETDLANMQTEGASAFPSGASVAGTYVTRAPTRKGKISPTSSIISGMDPRMSQEPMGGGSGILPMVTAQR
DRFKKKNTQLEQDLGEAHKTVRQLRQEVAALQKDNLNLYEKTRYVSTYNRGGATASAYATNPNPSTVSIGGTGNP
GISLDRYRKAYESNLSPFAAFRGRESARAYGRMSFPERVVYSITRMVLASRASRNLFAAYCVALHVLVFLSLYWL
GSSDLEKHGSNFRSSAAAAAAAAVSRDGPLAGGGVEHGKWREEGFNGQ*
Coding >Ophcf2|06102
ATGGCCGGCGACGCTCAAGCGCCTGCGCCAGCTGCAGGCGCAGTTACGGAGCCGACTTCAAACCCAGCAGAAGGG
GGCAACAAGTTCCAAGATGCCATCTCGGCATGGCGGAATGTCGATCTCACGACTTTGACGGCAACGCTCGATAAC
ACGGCGTCGGAAATCGTGACTTATCAACGAGATTCGACCGTCCAGCGCAAGGATCTCGCGCAAAAGACAAAGGAG
TTTCGAAAGCTGGACGACGCCTCTAAGCTGGTAGAAGTCAAGGGTCTTCTCAAAGCCTACCAAACATTCATTGAC
CTCCTCACTACGCACTCCAAATCTGTCAACTCTGCTTTTCTCCAAACGTACAGCTCAATATCCGAAGCCCCCGAT
CCGTATCCGCTCCTAGAGGCCGCTGTCGACTCCATGCTCGTGACGGAAGAGACGCTTCCGAGAGTTACGGAAGAG
AACCAGCGGCTTCAGGAAACTGTGGCGAGGCTGACGTCTCAGCTAGGAGAGGCCGAATCCATGCTGCAAGTCGAA
CGAGCCGCGCGCAAGGAGTCGGAAGACACACTCGAGGCCAGGGTCAAGGGCGTGGAATCGTCATGGACCGCCGTA
TTGGATGAGAAGAAAGACAACTGGGAAGCTCGGGAGACGAGTCTAGAGGAGAAGTTGGAAAATCAGGAGCGTCTC
CTCAGCGAGATGCGCGCGAGTTACGAGGTCGGCCAGCGGCTGGGCCTGAGCGGAGAGGATGCAGACGCCTCGCGC
GGTAACGCTTCGAGCGCCGAGCTGGAGATGCTGCACTCGGAGCTTGAGCAAAAAGGTGCCAGACTGGCCGAGGTA
GAAGCACGGAACGAGCAGATGAGGCTGGAGCTGGCTCGGGCCAAGTCGTCCATGTCTTCTCAGCCTGAAAAGTCT
CTCGAGGACGACCCGGACTTCATGCGGATGCGGACCGAGAATTCGTCACTGATCCGCAAGCTCGAGGCTGCCAGG
ATGGACAAGGAAAAACTGAAGCGCGATCTAGACACGCGGTTGCATATTATGGAGCGGGAGGCGTCGCAGTTAAAG
GAGGAGAGGGCTCTGCTCAAGTCCAAGATGCAGAAATGGAGTGATTACGACAATATCAAGCAAGAGTTGGAAGTT
CTCAAAAGCATAGAGTTCTCTACCGGCGATGACGACGAAGGCGGTGACAAGGCGGACGACGGCGCGGAAAAGGGC
GACACCTTGGAAATACTCCTACTATCGCGAAACAAGAAGCTCAGCGAGGAGCTCACCATTCTCCGTGTCTCCCAT
CGAGACCTCGACAGGAGGCTGGCGAGTATTCTGGAAGAGCTATCAGGGACCAAGGAAGAGCTCGAGAAGGCACAG
AAGCTCAATGAGAAGCTGGAGACTGATCTGGCTAACATGCAGACCGAAGGGGCGAGCGCTTTCCCGTCGGGAGCG
TCTGTGGCCGGAACGTACGTGACGCGTGCGCCTACTCGAAAGGGCAAGATATCGCCGACGTCGTCCATCATCAGC
GGGATGGACCCGCGGATGTCGCAAGAGCCGATGGGCGGCGGGTCCGGCATCCTGCCCATGGTTACGGCACAAAGA
GACCGGTTCAAAAAGAAGAACACGCAGCTGGAGCAGGACCTGGGCGAGGCGCACAAGACGGTTCGTCAGCTGCGA
CAAGAAGTGGCAGCGCTTCAGAAGGACAACTTGAACCTATACGAGAAGACGCGTTACGTGTCGACGTACAATCGG
GGCGGCGCGACGGCTTCAGCATACGCGACGAACCCGAACCCGTCGACGGTCTCGATCGGAGGGACGGGCAACCCG
GGCATCTCACTGGATCGGTACCGCAAGGCGTACGAGTCCAACCTGTCGCCCTTTGCGGCTTTCCGGGGCCGCGAG
TCGGCGAGAGCGTACGGACGGATGAGCTTCCCGGAGAGGGTCGTGTACTCCATCACGAGGATGGTGCTGGCGTCA
CGGGCTAGCAGGAACCTGTTCGCGGCCTACTGCGTCGCGCTGCACGTTCTGGTCTTCCTGTCGCTATACTGGCTG
GGAAGCTCGGACCTGGAGAAGCACGGGAGCAACTTCAGATCATCGGCGGCGGCGGCGGCGGCGGCGGCGGTCAGC
CGGGACGGACCCTTGGCGGGAGGCGGAGTGGAGCACGGGAAATGGCGGGAGGAAGGCTTCAACGGACAGTGA
Transcript >Ophcf2|06102
ATGGCCGGCGACGCTCAAGCGCCTGCGCCAGCTGCAGGCGCAGTTACGGAGCCGACTTCAAACCCAGCAGAAGGG
GGCAACAAGTTCCAAGATGCCATCTCGGCATGGCGGAATGTCGATCTCACGACTTTGACGGCAACGCTCGATAAC
ACGGCGTCGGAAATCGTGACTTATCAACGAGATTCGACCGTCCAGCGCAAGGATCTCGCGCAAAAGACAAAGGAG
TTTCGAAAGCTGGACGACGCCTCTAAGCTGGTAGAAGTCAAGGGTCTTCTCAAAGCCTACCAAACATTCATTGAC
CTCCTCACTACGCACTCCAAATCTGTCAACTCTGCTTTTCTCCAAACGTACAGCTCAATATCCGAAGCCCCCGAT
CCGTATCCGCTCCTAGAGGCCGCTGTCGACTCCATGCTCGTGACGGAAGAGACGCTTCCGAGAGTTACGGAAGAG
AACCAGCGGCTTCAGGAAACTGTGGCGAGGCTGACGTCTCAGCTAGGAGAGGCCGAATCCATGCTGCAAGTCGAA
CGAGCCGCGCGCAAGGAGTCGGAAGACACACTCGAGGCCAGGGTCAAGGGCGTGGAATCGTCATGGACCGCCGTA
TTGGATGAGAAGAAAGACAACTGGGAAGCTCGGGAGACGAGTCTAGAGGAGAAGTTGGAAAATCAGGAGCGTCTC
CTCAGCGAGATGCGCGCGAGTTACGAGGTCGGCCAGCGGCTGGGCCTGAGCGGAGAGGATGCAGACGCCTCGCGC
GGTAACGCTTCGAGCGCCGAGCTGGAGATGCTGCACTCGGAGCTTGAGCAAAAAGGTGCCAGACTGGCCGAGGTA
GAAGCACGGAACGAGCAGATGAGGCTGGAGCTGGCTCGGGCCAAGTCGTCCATGTCTTCTCAGCCTGAAAAGTCT
CTCGAGGACGACCCGGACTTCATGCGGATGCGGACCGAGAATTCGTCACTGATCCGCAAGCTCGAGGCTGCCAGG
ATGGACAAGGAAAAACTGAAGCGCGATCTAGACACGCGGTTGCATATTATGGAGCGGGAGGCGTCGCAGTTAAAG
GAGGAGAGGGCTCTGCTCAAGTCCAAGATGCAGAAATGGAGTGATTACGACAATATCAAGCAAGAGTTGGAAGTT
CTCAAAAGCATAGAGTTCTCTACCGGCGATGACGACGAAGGCGGTGACAAGGCGGACGACGGCGCGGAAAAGGGC
GACACCTTGGAAATACTCCTACTATCGCGAAACAAGAAGCTCAGCGAGGAGCTCACCATTCTCCGTGTCTCCCAT
CGAGACCTCGACAGGAGGCTGGCGAGTATTCTGGAAGAGCTATCAGGGACCAAGGAAGAGCTCGAGAAGGCACAG
AAGCTCAATGAGAAGCTGGAGACTGATCTGGCTAACATGCAGACCGAAGGGGCGAGCGCTTTCCCGTCGGGAGCG
TCTGTGGCCGGAACGTACGTGACGCGTGCGCCTACTCGAAAGGGCAAGATATCGCCGACGTCGTCCATCATCAGC
GGGATGGACCCGCGGATGTCGCAAGAGCCGATGGGCGGCGGGTCCGGCATCCTGCCCATGGTTACGGCACAAAGA
GACCGGTTCAAAAAGAAGAACACGCAGCTGGAGCAGGACCTGGGCGAGGCGCACAAGACGGTTCGTCAGCTGCGA
CAAGAAGTGGCAGCGCTTCAGAAGGACAACTTGAACCTATACGAGAAGACGCGTTACGTGTCGACGTACAATCGG
GGCGGCGCGACGGCTTCAGCATACGCGACGAACCCGAACCCGTCGACGGTCTCGATCGGAGGGACGGGCAACCCG
GGCATCTCACTGGATCGGTACCGCAAGGCGTACGAGTCCAACCTGTCGCCCTTTGCGGCTTTCCGGGGCCGCGAG
TCGGCGAGAGCGTACGGACGGATGAGCTTCCCGGAGAGGGTCGTGTACTCCATCACGAGGATGGTGCTGGCGTCA
CGGGCTAGCAGGAACCTGTTCGCGGCCTACTGCGTCGCGCTGCACGTTCTGGTCTTCCTGTCGCTATACTGGCTG
GGAAGCTCGGACCTGGAGAAGCACGGGAGCAACTTCAGATCATCGGCGGCGGCGGCGGCGGCGGCGGCGGTCAGC
CGGGACGGACCCTTGGCGGGAGGCGGAGTGGAGCACGGGAAATGGCGGGAGGAAGGCTTCAACGGACAGTGA
Gene >Ophcf2|06102
ATGGCCGGCGACGCTCAAGCGCCTGCGCCAGCTGCAGGCGCAGTTACGGAGCCGACTTCAAACCCAGCAGAAGGG
GGCAACAAGTTCCAAGATGCCATCTCGGCATGGCGGAGTACGCTCTTATCAGCAATCCTGCTCGCATAATTACTG
ACGCAGTTGGACACAGATGTCGATCTCACGACTTTGACGGCAACGCTCGATAACACGGCGTCGGAAATCGTGACT
TATCAACGAGATTCGACCGTCCAGCGCAAGGATCTCGCGCAAAAGACAAAGGAGTTTCGAAAGCTGGACGACGCC
TCTAAGCTGGTAGAAGTCAAGGGTCTTCTCAAAGGTATCGTCTACGAACAAGGTGGCGGACGACTTGGCTAACGC
TACTAACAGCCTACCAAACATTCATTGACCTCCTCACTACGCACTCCAAATCTGTCAACTCTGCTTTTCTCCAAA
CGTACAGCTCAATATCCGAAGCCCCCGATCCGTATCCGCTCCTAGAGGCCGCTGTCGACTCCATGCTCGTGACGG
AAGAGACGCTTCCGAGAGTTACGGAAGAGAACCAGCGGCTTCAGGAAACTGTGGCGAGGCTGACGTCTCAGCTAG
GAGAGGCCGAATCCATGCTGCAAGTCGAACGAGCCGCGCGCAAGGAGTCGGAAGACACACTCGAGGCCAGGGTCA
AGGGCGTGGAATCGTCATGGACCGCCGTATTGGATGAGAAGAAAGACAACTGGGAAGCTCGGGAGACGAGTCTAG
AGGAGAAGTTGGAAAATCAGGAGCGTCTCCTCAGCGAGATGCGCGCGAGTTACGAGGTCGGCCAGCGGCTGGGCC
TGAGCGGAGAGGATGCAGACGCCTCGCGCGGTAACGCTTCGAGCGCCGAGCTGGAGATGCTGCACTCGGAGCTTG
AGCAAAAAGGTGCCAGACTGGCCGAGGTAGAAGCACGGAACGAGCAGATGAGGCTGGAGCTGGCTCGGGCCAAGT
CGTCCATGTCTTCTCAGCCTGAAAAGTCTCTCGAGGACGACCCGGACTTCATGCGGATGCGGACCGAGAATTCGT
CACTGATCCGCAAGCTCGAGGCTGCCAGGATGGACAAGGAAAAACTGAAGCGCGATCTAGACACGCGGTTGCATA
TTATGGAGCGGGAGGCGTCGCAGTTAAAGGAGGAGAGGGCTCTGCTCAAGTCCAAGATGCAGAAATGGAGTGATT
ACGACAATATCAAGCAAGAGTTGGAAGTTCTCAAAAGCATAGAGTTCTCTACCGGCGATGACGACGAAGGCGGTG
ACAAGGCGGACGACGGCGCGGAAAAGGGCGACACCTTGGAAATACTCCTACTATCGCGAAACAAGAAGCTCAGCG
AGGAGCTCACCATTCTCCGTGTCTCCCATCGAGACCTCGACAGGAGGCTGGCGAGTATTCTGGAAGAGCTATCAG
GGACCAAGGAAGAGCTCGAGAAGGCACAGAAGCTCAATGAGAAGCTGGAGACTGATCTGGCTAACATGCAGACCG
AAGGGGCGAGCGCTTTCCCGTCGGGAGCGTCTGTGGCCGGAACGTACGTGACGCGTGCGCCTACTCGAAAGGGCA
AGATATCGCCGACGTCGTCCATCATCAGCGGGATGGACCCGCGGATGTCGCAAGAGCCGATGGGCGGCGGGTCCG
GCATCCTGCCCATGGTTACGGCACAAAGAGACCGGTTCAAAAAGAAGAACACGCAGCTGGAGCAGGACCTGGGCG
AGGCGCACAAGACGGTTCGTCAGCTGCGACAAGAAGTGGCAGCGCTTCAGAAGGACAACTTGAACCTATACGAGA
AGACGCGTTACGTGTCGACGTACAATCGGGGCGGCGCGACGGCTTCAGCATACGCGACGAACCCGAACCCGTCGA
CGGTCTCGATCGGAGGGACGGGCAACCCGGGCATCTCACTGGATCGGTACCGCAAGGCGTACGAGTCCAACCTGT
CGCCCTTTGCGGCTTTCCGGGGCCGCGAGTCGGCGAGAGCGTACGGACGGATGAGCTTCCCGGAGAGGGTCGTGT
ACTCCATCACGAGGATGGTGCTGGCGTCACGGGCTAGCAGGAACCTGTTCGCGGCCTACTGCGTCGCGCTGCACG
TTCTGGTCTTCCTGTCGCTATACTGGCTGGGAAGCTCGGACCTGGAGAAGCACGGGAGCAACTTCAGATCATCGG
CGGCGGCGGCGGCGGCGGCGGCGGTCAGCCGGGACGGACCCTTGGCGGGAGGCGGAGTGGAGCACGGGAAATGGC
GGGAGGAAGGCTTCAACGGACAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail