Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06101
Gene name
Locationscaffold_07:1249310..1253080
Strand-
Gene length (bp)3770
Transcript length (bp)3510
Coding sequence length (bp)3510
Protein length (aa) 1170

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10367 Vps39_2 Vacuolar sorting protein 39 domain 2 1.4E-07 1092 1156

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.5203 0.5362 0.0977 0.0434 0.0686 0.0111 0.2161 0.4176 0.3716 0.0327

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1281
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7225
Ophiocordyceps australis map64 (Brazil) OphauB2|650
Ophiocordyceps camponoti-floridani Ophcf2|06101 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5981
Ophiocordyceps kimflemingae Ophio5|7765
Ophiocordyceps subramaniannii Hirsu2|10573

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06101
MSDLQLHPLVPEPATTSFWLNYNDAQSRELWLRMSTSRGSSPCRVAYPYREDGPYVLRPLLDDVPLSADGTNGHV
VINCVEYLNGNLYVGTSASELLHFVQIPPDPADKSRTPIFILASRLAPAFSDSSGALESSRPGVQEILLLPGVGK
ACVLCNWTVTFYSLPELSPLSGTGQVKNCNWIGGTDLNRATPRGADVTVLLLLKRRIQVVQVGESARAFKNIDYA
GSTLCVRRDSIACVADSKSYALLDIERQLKIPLMSISSLDEPPPPEEVGQAQSIAGDSGGAILRSVSSAENRTQS
VSQIHNRSASLGGSILSNIRRQETPRTEEGSVGPSTPPNAPSSPRPRSAESGIGVSSTDKPLPENPPASEVVIAT
QAVEQQAAQRAVRLKPHIASLTAEEFLVVIGTSPSEPGIGMFVNLDGDATRATIGFEQYPLQVAVDGSQTDLSPS
RNGLPEDGDGYVLASMAKSIGHQPQYGLEIQRWGAGNENNPEKHWLVAEEAEDTGAYGIGSLAGRSEIQFEAIVA
KLCNRRFYAFSSTIEASTPSARSLDSRTASSIERLYKERELFERDDLQDDDPLPDGWEVTRVAEEDEFVRRLAKT
QVRLAVWAGGRIWWAVRNPLLLQLDTLLDAACPAGFSEGQEMDRGVILSVIDAIRGRDAKTELEFLTFCYLRQKT
GLLLLITLLTSDDETETLSDNQLGILEAVLIDSKLDARVVLALVPGLRNEIIEGRRGIWIYGGVRQVANAFLRGN
SFQSIAKAGLSSLSPRVLHSMRRFLWSWRKMKGFGSVADESQVFQTVDAALLTILLQLDQDSPKGLGKGGVVRSE
LNDVVDKGVECFDRAVDLLESYHRLFILSRLYQSRKMVGDVLSTWKRIIEGHRDDGQELRDGEQRVRDYLAKVSN
PALVREYGVWLANRNPAMGVQVFAEERSKCPRLEPAAVVNLLREEAPAAVKHYLEHLVFGLNNEAYVNDLINYYL
DLILDQLTCSPSSRQAVMTAYEAYRALRPPKPTYQHFLTENATPHDSTSQSRLRLLQLLGGPYDIDAPSIRARLE
ALDGDLLVPETIMLAGRDHLHDDALRLLVHTLGDYDTATGNLLDRFGPWFDVHQVLPLIPPSWPLDVIAAFLVAA
FKRLVRQKHESRVARALTAAENLRVSYNVVSAVDRIGPVVEATN*
Coding >Ophcf2|06101
ATGTCGGACCTCCAGCTTCATCCTCTAGTTCCTGAACCCGCAACGACAAGCTTCTGGCTTAACTACAACGATGCC
CAAAGCCGTGAGCTGTGGCTCAGAATGTCTACGTCCCGGGGGTCTTCCCCATGCCGCGTGGCTTACCCCTATCGG
GAAGACGGCCCGTATGTGTTGCGGCCGTTGCTGGATGACGTGCCGCTATCGGCGGACGGCACGAATGGCCATGTT
GTCATAAACTGCGTCGAGTATCTCAATGGCAATCTCTACGTCGGCACGTCAGCCTCGGAGCTGCTTCACTTCGTC
CAAATACCGCCTGACCCAGCTGATAAATCCCGAACCCCCATATTTATCCTCGCTTCGAGGCTCGCGCCCGCCTTC
TCCGATTCCTCCGGGGCTCTGGAGAGCTCACGGCCTGGTGTTCAGGAGATTTTGCTATTGCCCGGCGTGGGCAAG
GCCTGCGTTCTCTGCAACTGGACCGTCACATTCTATTCGTTGCCGGAGCTGAGTCCTCTGTCCGGTACGGGACAG
GTCAAGAACTGCAACTGGATAGGCGGAACAGACCTGAATAGGGCTACGCCTCGAGGTGCCGACGTTACGGTACTG
CTCTTGCTTAAGCGACGAATACAGGTGGTTCAAGTTGGAGAGAGCGCGCGAGCTTTCAAGAACATTGACTACGCA
GGCAGCACCTTGTGCGTCAGGAGAGACTCTATAGCATGCGTCGCCGACTCCAAGTCGTACGCGCTGCTCGACATC
GAGAGACAGCTGAAGATTCCGCTGATGAGCATATCATCTCTGGATGAGCCGCCGCCACCCGAGGAAGTTGGACAG
GCCCAGAGCATCGCTGGCGACTCTGGAGGGGCCATTTTACGCAGCGTCTCTTCTGCTGAAAACAGGACGCAATCT
GTGTCCCAAATCCACAATCGAAGCGCTAGCTTGGGAGGCTCTATTCTCAGCAATATTCGTCGTCAAGAGACTCCC
AGAACGGAGGAGGGTTCGGTCGGTCCATCCACACCCCCTAATGCTCCTTCGAGTCCGAGGCCGCGATCCGCCGAG
TCCGGCATAGGAGTTTCATCGACCGACAAGCCACTGCCAGAGAATCCACCCGCCTCCGAGGTTGTCATTGCCACT
CAGGCTGTTGAGCAACAAGCAGCCCAAAGAGCTGTCAGATTGAAACCTCACATTGCTTCTTTGACGGCCGAAGAG
TTTCTCGTCGTCATAGGCACCAGCCCCTCGGAACCGGGCATTGGCATGTTTGTCAATCTCGATGGCGATGCTACG
CGCGCAACAATCGGCTTCGAGCAGTACCCATTGCAGGTAGCTGTGGATGGTTCGCAGACGGACCTTTCCCCCTCA
CGGAACGGGTTGCCGGAAGACGGCGATGGATATGTCCTAGCGTCCATGGCCAAGAGTATAGGGCACCAGCCACAA
TATGGCCTTGAGATTCAACGATGGGGAGCCGGTAACGAAAATAACCCCGAGAAGCATTGGCTGGTGGCCGAGGAA
GCTGAAGACACCGGCGCATACGGCATTGGCTCGCTGGCAGGGCGAAGCGAGATCCAGTTCGAGGCCATTGTGGCC
AAACTATGCAATCGGAGATTTTATGCCTTTTCCAGTACGATAGAAGCGTCGACGCCATCAGCGCGGAGTTTAGAC
TCGCGCACGGCCTCGTCTATCGAACGGTTGTATAAAGAACGGGAGCTCTTCGAGCGAGATGACCTGCAGGACGAT
GACCCCTTACCGGACGGGTGGGAAGTAACACGGGTTGCAGAGGAGGACGAGTTTGTTCGTCGACTGGCCAAGACG
CAGGTCAGGTTGGCCGTATGGGCAGGCGGCCGCATCTGGTGGGCAGTGAGGAATCCGCTGCTGCTCCAGCTCGAC
ACCCTCCTGGACGCGGCGTGTCCGGCCGGCTTTTCCGAAGGTCAGGAAATGGACAGAGGAGTGATCCTGTCCGTC
ATCGACGCGATTCGCGGCCGAGATGCAAAAACTGAACTGGAATTCCTCACCTTTTGCTACCTGCGGCAGAAGACG
GGCCTCCTACTTCTCATCACGCTTCTGACATCAGACGACGAGACGGAGACATTGTCCGACAATCAGCTCGGGATA
TTGGAAGCAGTCCTCATAGACAGCAAGCTGGATGCCAGAGTCGTGCTAGCACTAGTGCCAGGCCTTCGAAACGAG
ATCATCGAAGGTCGACGAGGCATATGGATCTATGGCGGCGTCAGACAAGTGGCAAACGCCTTCCTCCGCGGCAAC
TCCTTCCAGAGCATCGCCAAGGCTGGACTGAGCAGCCTCAGCCCAAGAGTCCTTCACTCCATGCGCCGCTTCCTC
TGGTCATGGAGGAAAATGAAGGGCTTCGGAAGCGTAGCAGACGAAAGCCAAGTCTTCCAAACGGTAGACGCCGCC
CTACTCACCATCCTCCTCCAGCTAGACCAAGACTCACCAAAAGGCCTCGGCAAAGGCGGCGTCGTCCGGTCCGAA
CTCAACGACGTGGTAGACAAGGGCGTCGAGTGCTTCGACAGAGCCGTCGACCTTCTCGAGTCGTACCACCGGCTC
TTCATCCTCAGCAGACTATACCAAAGCCGCAAGATGGTAGGCGACGTCCTATCCACGTGGAAGCGCATCATCGAA
GGTCACCGCGACGACGGCCAAGAACTCCGCGACGGAGAGCAACGCGTGCGAGACTATCTAGCAAAAGTCAGTAAC
CCAGCCCTCGTCCGCGAGTACGGCGTCTGGCTCGCGAACCGCAACCCAGCCATGGGCGTACAAGTCTTCGCCGAG
GAGAGAAGCAAATGCCCCAGATTGGAACCAGCTGCCGTCGTCAACCTCCTCCGAGAAGAAGCACCCGCCGCAGTC
AAGCATTACCTCGAACACCTCGTCTTCGGCCTCAACAACGAAGCCTACGTCAACGACCTAATCAACTACTACCTC
GACCTCATCCTCGACCAACTCACATGCTCGCCATCCAGCCGACAAGCCGTAATGACCGCCTACGAAGCATACCGC
GCCCTCCGACCCCCCAAACCAACCTACCAACACTTCCTCACCGAAAACGCAACCCCCCACGACTCAACCTCCCAA
AGCAGACTCCGCCTCCTCCAACTCCTAGGCGGACCCTACGACATCGACGCCCCCTCCATCCGCGCCCGTCTCGAA
GCCCTAGACGGAGACCTCCTCGTCCCCGAAACAATCATGCTGGCAGGCCGCGACCATCTCCACGACGACGCCCTC
CGCCTCCTCGTCCACACCCTGGGCGACTACGACACGGCAACGGGTAACCTCCTCGATCGCTTCGGCCCCTGGTTC
GACGTCCATCAGGTCCTACCCCTCATCCCCCCCTCCTGGCCCCTCGACGTCATCGCCGCTTTCCTCGTCGCTGCC
TTTAAGAGGCTCGTCAGGCAGAAGCATGAGTCCCGCGTCGCCAGGGCGCTCACGGCCGCCGAGAATCTGCGCGTC
AGCTACAATGTCGTCTCCGCCGTGGATCGGATAGGACCCGTGGTCGAGGCGACGAACTGA
Transcript >Ophcf2|06101
ATGTCGGACCTCCAGCTTCATCCTCTAGTTCCTGAACCCGCAACGACAAGCTTCTGGCTTAACTACAACGATGCC
CAAAGCCGTGAGCTGTGGCTCAGAATGTCTACGTCCCGGGGGTCTTCCCCATGCCGCGTGGCTTACCCCTATCGG
GAAGACGGCCCGTATGTGTTGCGGCCGTTGCTGGATGACGTGCCGCTATCGGCGGACGGCACGAATGGCCATGTT
GTCATAAACTGCGTCGAGTATCTCAATGGCAATCTCTACGTCGGCACGTCAGCCTCGGAGCTGCTTCACTTCGTC
CAAATACCGCCTGACCCAGCTGATAAATCCCGAACCCCCATATTTATCCTCGCTTCGAGGCTCGCGCCCGCCTTC
TCCGATTCCTCCGGGGCTCTGGAGAGCTCACGGCCTGGTGTTCAGGAGATTTTGCTATTGCCCGGCGTGGGCAAG
GCCTGCGTTCTCTGCAACTGGACCGTCACATTCTATTCGTTGCCGGAGCTGAGTCCTCTGTCCGGTACGGGACAG
GTCAAGAACTGCAACTGGATAGGCGGAACAGACCTGAATAGGGCTACGCCTCGAGGTGCCGACGTTACGGTACTG
CTCTTGCTTAAGCGACGAATACAGGTGGTTCAAGTTGGAGAGAGCGCGCGAGCTTTCAAGAACATTGACTACGCA
GGCAGCACCTTGTGCGTCAGGAGAGACTCTATAGCATGCGTCGCCGACTCCAAGTCGTACGCGCTGCTCGACATC
GAGAGACAGCTGAAGATTCCGCTGATGAGCATATCATCTCTGGATGAGCCGCCGCCACCCGAGGAAGTTGGACAG
GCCCAGAGCATCGCTGGCGACTCTGGAGGGGCCATTTTACGCAGCGTCTCTTCTGCTGAAAACAGGACGCAATCT
GTGTCCCAAATCCACAATCGAAGCGCTAGCTTGGGAGGCTCTATTCTCAGCAATATTCGTCGTCAAGAGACTCCC
AGAACGGAGGAGGGTTCGGTCGGTCCATCCACACCCCCTAATGCTCCTTCGAGTCCGAGGCCGCGATCCGCCGAG
TCCGGCATAGGAGTTTCATCGACCGACAAGCCACTGCCAGAGAATCCACCCGCCTCCGAGGTTGTCATTGCCACT
CAGGCTGTTGAGCAACAAGCAGCCCAAAGAGCTGTCAGATTGAAACCTCACATTGCTTCTTTGACGGCCGAAGAG
TTTCTCGTCGTCATAGGCACCAGCCCCTCGGAACCGGGCATTGGCATGTTTGTCAATCTCGATGGCGATGCTACG
CGCGCAACAATCGGCTTCGAGCAGTACCCATTGCAGGTAGCTGTGGATGGTTCGCAGACGGACCTTTCCCCCTCA
CGGAACGGGTTGCCGGAAGACGGCGATGGATATGTCCTAGCGTCCATGGCCAAGAGTATAGGGCACCAGCCACAA
TATGGCCTTGAGATTCAACGATGGGGAGCCGGTAACGAAAATAACCCCGAGAAGCATTGGCTGGTGGCCGAGGAA
GCTGAAGACACCGGCGCATACGGCATTGGCTCGCTGGCAGGGCGAAGCGAGATCCAGTTCGAGGCCATTGTGGCC
AAACTATGCAATCGGAGATTTTATGCCTTTTCCAGTACGATAGAAGCGTCGACGCCATCAGCGCGGAGTTTAGAC
TCGCGCACGGCCTCGTCTATCGAACGGTTGTATAAAGAACGGGAGCTCTTCGAGCGAGATGACCTGCAGGACGAT
GACCCCTTACCGGACGGGTGGGAAGTAACACGGGTTGCAGAGGAGGACGAGTTTGTTCGTCGACTGGCCAAGACG
CAGGTCAGGTTGGCCGTATGGGCAGGCGGCCGCATCTGGTGGGCAGTGAGGAATCCGCTGCTGCTCCAGCTCGAC
ACCCTCCTGGACGCGGCGTGTCCGGCCGGCTTTTCCGAAGGTCAGGAAATGGACAGAGGAGTGATCCTGTCCGTC
ATCGACGCGATTCGCGGCCGAGATGCAAAAACTGAACTGGAATTCCTCACCTTTTGCTACCTGCGGCAGAAGACG
GGCCTCCTACTTCTCATCACGCTTCTGACATCAGACGACGAGACGGAGACATTGTCCGACAATCAGCTCGGGATA
TTGGAAGCAGTCCTCATAGACAGCAAGCTGGATGCCAGAGTCGTGCTAGCACTAGTGCCAGGCCTTCGAAACGAG
ATCATCGAAGGTCGACGAGGCATATGGATCTATGGCGGCGTCAGACAAGTGGCAAACGCCTTCCTCCGCGGCAAC
TCCTTCCAGAGCATCGCCAAGGCTGGACTGAGCAGCCTCAGCCCAAGAGTCCTTCACTCCATGCGCCGCTTCCTC
TGGTCATGGAGGAAAATGAAGGGCTTCGGAAGCGTAGCAGACGAAAGCCAAGTCTTCCAAACGGTAGACGCCGCC
CTACTCACCATCCTCCTCCAGCTAGACCAAGACTCACCAAAAGGCCTCGGCAAAGGCGGCGTCGTCCGGTCCGAA
CTCAACGACGTGGTAGACAAGGGCGTCGAGTGCTTCGACAGAGCCGTCGACCTTCTCGAGTCGTACCACCGGCTC
TTCATCCTCAGCAGACTATACCAAAGCCGCAAGATGGTAGGCGACGTCCTATCCACGTGGAAGCGCATCATCGAA
GGTCACCGCGACGACGGCCAAGAACTCCGCGACGGAGAGCAACGCGTGCGAGACTATCTAGCAAAAGTCAGTAAC
CCAGCCCTCGTCCGCGAGTACGGCGTCTGGCTCGCGAACCGCAACCCAGCCATGGGCGTACAAGTCTTCGCCGAG
GAGAGAAGCAAATGCCCCAGATTGGAACCAGCTGCCGTCGTCAACCTCCTCCGAGAAGAAGCACCCGCCGCAGTC
AAGCATTACCTCGAACACCTCGTCTTCGGCCTCAACAACGAAGCCTACGTCAACGACCTAATCAACTACTACCTC
GACCTCATCCTCGACCAACTCACATGCTCGCCATCCAGCCGACAAGCCGTAATGACCGCCTACGAAGCATACCGC
GCCCTCCGACCCCCCAAACCAACCTACCAACACTTCCTCACCGAAAACGCAACCCCCCACGACTCAACCTCCCAA
AGCAGACTCCGCCTCCTCCAACTCCTAGGCGGACCCTACGACATCGACGCCCCCTCCATCCGCGCCCGTCTCGAA
GCCCTAGACGGAGACCTCCTCGTCCCCGAAACAATCATGCTGGCAGGCCGCGACCATCTCCACGACGACGCCCTC
CGCCTCCTCGTCCACACCCTGGGCGACTACGACACGGCAACGGGTAACCTCCTCGATCGCTTCGGCCCCTGGTTC
GACGTCCATCAGGTCCTACCCCTCATCCCCCCCTCCTGGCCCCTCGACGTCATCGCCGCTTTCCTCGTCGCTGCC
TTTAAGAGGCTCGTCAGGCAGAAGCATGAGTCCCGCGTCGCCAGGGCGCTCACGGCCGCCGAGAATCTGCGCGTC
AGCTACAATGTCGTCTCCGCCGTGGATCGGATAGGACCCGTGGTCGAGGCGACGAACTGA
Gene >Ophcf2|06101
ATGTCGGACCTCCAGCTTCATCCTCTAGTTCCTGAACCCGCAACGACAAGCTTCTGGCTTAACTACAACGATGCC
CAAAGCCGTGAGCTGTGGCTCAGAATGTCTACGTCCCGGGGGTCTTCCCCATGCCGCGTGGCTTACCCCTATCGG
GAAGACGGCCCGTATGTGTTGCGGCCGTTGCTGGATGACGTGCCGCTATCGGCGGACGGCACGAATGGCCATGTT
GTCATAAACTGCGTCGAGTATCTCAGTGAGACTGCAAATGCCTTTTCCAGAAGATCTTTGAGCTGAAATAACTTG
CTTCAATCAGATGGCAATCTCTACGTCGGCACGTCAGCCTCGGAGCTGCTTCACTTCGTCCAAATACCGCCTGAC
CCAGCTGATAAATCCCGAACCCCCATATTTATCCTCGCTTCGAGGCTCGCGCCCGCCTTCTCCGATTCCTCCGGG
GCTCTGGAGAGCTCACGGCCTGGTGTTCAGGAGATTTTGCTATTGCCCGGCGTGGGCAAGGCCTGCGTTCTCTGC
AACTGGACCGTCACATTCTATTCGTTGCCGGAGCTGAGTCCTCTGTCCGGTACGGGACAGGTCAAGAACTGCAAC
TGGATAGGCGGAACAGACCTGAATAGGGCTACGCCTCGAGGTGCCGACGTTACGGTACTGCTCTTGCTTAAGCGA
CGAATACAGGTGGTTCAAGTTGGAGAGAGCGCGCGAGCTTTCAAGGTAGGTCCCGATGCCACGGTATCATGCTTT
CGGAAGTGGTCTGATTTGCTTTCAGAACATTGACTACGCAGGCAGCACCTTGTGCGTCAGGAGAGACTCTATAGC
ATGCGTCGCCGACTCCAAGTCGTACGCGCTGCTCGACATCGAGAGACAGCTGAAGATTCCGCTGATGAGCATATC
ATCTCTGGATGAGCCGCCGCCACCCGAGGAAGTTGGACAGGCCCAGAGCATCGCTGGCGACTCTGGAGGGGCCAT
TTTACGCAGCGTCTCTTCTGCTGAAAACAGGACGCAATCTGTGTCCCAAATCCACAATCGAAGCGCTAGCTTGGG
AGGCTCTATTCTCAGCAATATTCGTCGTCAAGAGACTCCCAGAACGGAGGAGGGTTCGGTCGGTCCATCCACACC
CCCTAATGCTCCTTCGAGTCCGAGGCCGCGATCCGCCGAGTCCGGCATAGGAGTTTCATCGACCGACAAGCCACT
GCCAGAGAATCCACCCGCCTCCGAGGTTGTCATTGCCACTCAGGCTGTTGAGCAACAAGCAGCCCAAAGAGCTGT
CAGATTGAAACCTCACATTGCTTCTTTGACGGCCGAAGAGTTTCTCGTCGTCATAGGCACCAGCCCCTCGGAACC
GGGCATTGGCATGTTTGTCAATCTCGATGGCGATGCTACGCGCGCAACAATCGGCTTCGAGCAGTACCCATTGCA
GGTAGCTGTGGATGGTTCGCAGACGGACCTTTCCCCCTCACGGAACGGGTTGCCGGAAGACGGCGATGGATATGT
CCTAGCGTCCATGGCCAAGAGTATAGGGCACCAGCCACAATATGGCCTTGAGATTCAACGATGGGGAGCCGGTAA
CGAAAATAACCCCGAGAAGCATTGGCTGGTGGCCGAGGAAGCTGAAGACACCGGCGCATACGGCATTGGCTCGCT
GGCAGGGCGAAGCGAGATCCAGTTCGAGGCCATTGTGGCCAAACTATGCAATCGGAGATTTTATGCCTTTTCCAG
TACGATAGAAGCGTCGACGCCATCAGCGCGGAGTTTAGACTCGCGCACGGCCTCGTCTATCGAACGGTTGTATAA
AGAACGGGAGCTCTTCGAGCGAGATGACCTGCAGGACGATGACCCCTTACCGGACGGGTGGGAAGTAACACGGGT
TGCAGAGGAGGACGAGTTTGTTCGTCGACTGGCCAAGACGCAGGTCAGGTTGGCCGTATGGGCAGGCGGCCGCAT
CTGGTGGGCAGTGAGGAATCCGCTGCTGCTCCAGCTCGACACCCTCCTGGACGCGGCGTGTCCGGCCGGCTTTTC
CGAAGGTCAGGAAATGGACAGAGGAGTGATCCTGTCCGTCATCGACGCGATTCGCGGCCGAGATGCAAAAACTGA
ACTGGAATTCCTCACCTTTTGCTACCTGCGGCAGAAGACGGGCCTCCTACTTCTCATCACGCTTCTGACATCAGA
CGACGAGACGGAGACATTGTCCGACAATCAGCTCGGGATATTGGAAGCAGTCCTCATAGACAGCAAGCTGGATGC
CAGAGTCGTGCTAGCACTAGTGCCAGGCCTTCGAAACGAGATCATCGAAGGTCGACGAGGCATATGGATCTATGG
CGGCGTCAGACAAGTGGCAAACGCCTTCCTCCGCGGCAACTCCTTCCAGAGCATCGCCAAGGCTGGACTGAGCAG
CCTCAGCCCAAGAGTCCTTCACTCCATGCGCCGCTTCCTCTGGTCATGGAGGAAAATGAAGGGCTTCGGAAGCGT
AGCAGACGAAAGCCAAGTCTTCCAAACGGTAGACGCCGCCCTACTCACCATCCTCCTCCAGCTAGACCAAGACTC
ACCAAAAGGCCTCGGCAAAGGCGGCGTCGTCCGGTCCGAACTCAACGACGTGGTAGACAAGGGCGTCGAGTGCTT
CGACAGAGCCGTCGACCTTCTCGAGTCGTACCACCGGCTCTTCATCCTCAGCAGACTATACCAAAGCCGCAAGAT
GGTAGGCGACGTCCTATCCACGTGGAAGCGCATCATCGAAGGTCACCGCGACGACGGCCAAGAACTCCGCGACGG
AGAGCAACGCGTGCGAGACTATCTAGCAAAAGTCAGTAACCCAGCCCTCGTCCGCGAGTACGGCGTCTGGCTCGC
GAACCGCAACCCAGCCATGGGCGTACAAGTCTTCGCCGAGGAGAGAAGCAAATGCCCCAGATTGGAACCAGCTGC
CGTCGTCAACCTCCTCCGAGAAGAAGCACCCGCCGCAGTCAAGCATTACCTCGAACACCTCGTCTTCGGCCTCAA
CAACGAAGCCTACGTCAACGACCTAATCAACTACTACCTCGACCTCATCCTCGACCAACTCACATGCTCGCCATC
CAGCCGACAAGCCGTAATGACCGCCTACGAAGCATACCGCGCCCTCCGACCCCCCAAACCAACCTACCAACACTT
CCTCACCGAAAACGCAACCCCCCACGACTCAACCTCCCAAAGCAGACTCCGCCTCCTCCAACTCCTAGGCGGACC
CTACGACATCGACGCCCCCTCCATCCGCGCCCGTCTCGAAGCCCTAGACGGAGACCTCCTCGTCCCCGAAACAAT
CATGCTGGCAGGCCGCGACCATCTCCACGACGACGCCCTCCGCCTCCTCGTCCACACCCTGGGCGACTACGACAC
GGCAGTAGCCTACTGCCTCCGAGGCGGAACAAGCGTCTACGTCTCCACGCCCCGAACCCCCCCCCCCGACCCACC
AACGACGAGCCCTCTTCGCCACCCTCCTCCACCAATTCCTCGCCATACAAGACGTGGCCGATCGTCTCGAACAGA
CGGGTAACCTCCTCGATCGCTTCGGCCCCTGGTTCGACGTCCATCAGGTCCTACCCCTCATCCCCCCCTCCTGGC
CCCTCGACGTCATCGCCGCTTTCCTCGTCGCTGCCTTTAAGAGGCTCGTCAGGCAGAAGCATGAGTCCCGCGTCG
CCAGGGCGCTCACGGCCGCCGAGAATCTGCGCGTCAGCTACAATGTCGTCTCCGCCGTGGATCGGATAGGACCCG
TGGTCGAGGCGACGAACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail