Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06098
Gene name
Locationscaffold_07:1233207..1235820
Strand-
Gene length (bp)2613
Transcript length (bp)2397
Coding sequence length (bp)2397
Protein length (aa) 799

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.2E-09 345 398
PF13639 zf-RING_2 Ring finger domain 5.4E-08 344 398
PF13445 zf-RING_UBOX RING-type zinc-finger 1.4E-05 346 395
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 2.7E-05 346 397

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0046872 metal ion binding Yes
GO:0043169 cation binding No
GO:0046914 transition metal ion binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 5 23 18
2 38 60 22
3 99 121 22
4 136 158 22
5 281 303 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06098
MRLGWYAGVSTALAGGVVISAFLQRANFYSAMVYLAQSNFCLLALVNFSLLLYSSFIYGLTRICFGTLRAVEVEQ
LTERAWFAITETCLAMTIFREEIGAWFLVMFTALVTGKVWGWIGDGRVEFLEQQPPHNPRLFHLRLSISLGMSFL
YDILILRYSVRNVIQQARPNMMVMFLFEFAVLATCSWRTGARYMLVLAEQNIIKTQTRKRLFERRLEVREQREAM
LRRREQAAAAGEDAPADDEPLPNEDDVDEMDIEVPGWSAKGEWVLWLDLLSDMIKLSIYVAFFFMLLMFYGLPIH
IMRDLFMTSRDFIKRLNALLRYRRAIQEMNRYPDASADDLAQENTCIICREEMRPWDPVENPGAIDRVRPKKLPC
GHILHLGCLKSWLERQQVCPTCRSPVTAARPRGHPAAGAAGLRIQIGGQPRLQGQQPPADVGQQGQGNGDPQPRP
PREGGPRIFNIGPIRLGFGTNGQQFRELAQQFGVPHIAGNEAAPAPAAEQNQPTLADNLGSIANLLRQTEQLLQR
EAQRMHTAQQELQIVSLLMTELLRLQQRRLQTMEQPLAAQPPLQPWPQAAHGLPMNPPFPPAQQFAVPTLGTQPQ
YPGMPLLPGAPPRSGSPLMARLGTSGPTAPIPAGSADLPEGLTLPPGWSVVPLQRLDGSPSSASIPHPPQAPGHE
GDAATNSSQAANEAPASVPFPVGGHSAPPELAADEPASTEARQADEPAPVVAPSPVMPNWAGPSQLLHNGSRVNP
EEPKRSTVTPTTTVTSEHADTEGEQESASSSKGKGKAATVQDARDEED*
Coding >Ophcf2|06098
ATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATCTCGGCCTTTCTCCAGCGG
GCGAACTTTTATTCGGCCATGGTATATCTGGCTCAGAGCAACTTTTGCTTGCTGGCCTTGGTCAATTTTTCCCTC
CTTCTTTACAGTAGCTTCATCTACGGTCTGACGCGCATATGCTTCGGTACGCTGCGCGCTGTCGAGGTTGAGCAG
CTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGGGAGGAAATAGGGGCC
TGGTTCCTGGTCATGTTCACGGCGTTGGTAACTGGTAAGGTGTGGGGATGGATTGGCGACGGCCGAGTCGAATTT
CTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGACTTAGCATCTCCCTCGGCATGAGCTTCCTG
TACGATATCCTCATACTGCGATATTCGGTTCGAAACGTCATTCAGCAGGCACGTCCAAACATGATGGTCATGTTT
CTGTTTGAATTCGCGGTGCTGGCTACGTGCTCATGGCGCACAGGCGCTCGGTACATGCTCGTCTTGGCGGAACAG
AACATCATCAAGACCCAGACTAGGAAGAGGCTGTTTGAAAGAAGACTAGAAGTTCGGGAGCAGCGGGAGGCCATG
TTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCACCAGCCGACGACGAACCGTTACCGAACGAGGAC
GACGTCGACGAGATGGACATTGAAGTTCCCGGTTGGTCTGCCAAGGGGGAATGGGTACTCTGGCTTGATCTTCTC
AGTGATATGATCAAGCTCAGCATCTATGTTGCGTTCTTCTTCATGCTTCTCATGTTCTACGGCTTGCCCATACAC
ATCATGAGGGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGGCTAAACGCTCTATTGCGCTATCGCCGAGCC
ATCCAGGAGATGAACAGATACCCAGATGCGTCCGCCGACGACCTCGCGCAGGAGAACACGTGCATCATATGTCGA
GAGGAGATGAGGCCATGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTGCGGCCCAAGAAGTTGCCTTGC
GGCCACATCCTGCACCTCGGTTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGCAGGAGTCCA
GTAACAGCGGCTCGACCTCGCGGCCATCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGAGGCCAGCCG
AGGCTGCAAGGCCAGCAGCCGCCGGCGGATGTCGGCCAACAGGGTCAAGGGAACGGCGATCCACAGCCAAGGCCG
CCAAGAGAAGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGTTTCGGTACCAACGGCCAGCAGTTC
CGCGAGCTTGCCCAGCAGTTCGGGGTGCCGCACATCGCCGGCAACGAGGCGGCTCCGGCCCCAGCCGCCGAGCAG
AATCAGCCGACGTTGGCCGACAACCTCGGAAGCATCGCCAACCTTCTCCGACAGACGGAGCAACTACTCCAGCGT
GAAGCGCAGCGGATGCACACGGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGACCGAGTTGCTACGCCTA
CAGCAGCGTCGTCTGCAAACAATGGAACAGCCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCCCAGGCTGCC
CATGGCTTGCCGATGAACCCGCCCTTTCCACCAGCCCAACAGTTCGCAGTCCCCACTCTGGGGACACAGCCTCAA
TACCCTGGCATGCCCTTACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTCGGCACATCG
GGTCCCACGGCGCCCATCCCGGCCGGCAGCGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGATGGTCGGTG
GTTCCTCTGCAAAGGCTGGACGGTTCACCGAGTTCGGCCTCGATCCCTCACCCGCCACAGGCGCCCGGGCACGAA
GGAGACGCAGCGACGAACTCAAGCCAGGCAGCCAACGAGGCTCCAGCGTCCGTACCCTTTCCGGTCGGGGGCCAC
TCCGCTCCTCCAGAGCTCGCCGCCGATGAACCCGCTTCGACGGAAGCTCGCCAAGCCGACGAGCCAGCTCCAGTC
GTGGCCCCAAGTCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTACACAACGGTTCCCGCGTCAATCCC
GAAGAACCCAAGCGAAGCACAGTCACGCCAACAACAACAGTCACGAGCGAGCATGCAGACACCGAGGGCGAACAA
GAATCCGCCTCATCATCCAAAGGCAAGGGAAAGGCAGCCACCGTTCAAGACGCCCGCGACGAGGAAGATTGA
Transcript >Ophcf2|06098
ATGCGGCTCGGCTGGTACGCTGGGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATCTCGGCCTTTCTCCAGCGG
GCGAACTTTTATTCGGCCATGGTATATCTGGCTCAGAGCAACTTTTGCTTGCTGGCCTTGGTCAATTTTTCCCTC
CTTCTTTACAGTAGCTTCATCTACGGTCTGACGCGCATATGCTTCGGTACGCTGCGCGCTGTCGAGGTTGAGCAG
CTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGGGAGGAAATAGGGGCC
TGGTTCCTGGTCATGTTCACGGCGTTGGTAACTGGTAAGGTGTGGGGATGGATTGGCGACGGCCGAGTCGAATTT
CTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGACTTAGCATCTCCCTCGGCATGAGCTTCCTG
TACGATATCCTCATACTGCGATATTCGGTTCGAAACGTCATTCAGCAGGCACGTCCAAACATGATGGTCATGTTT
CTGTTTGAATTCGCGGTGCTGGCTACGTGCTCATGGCGCACAGGCGCTCGGTACATGCTCGTCTTGGCGGAACAG
AACATCATCAAGACCCAGACTAGGAAGAGGCTGTTTGAAAGAAGACTAGAAGTTCGGGAGCAGCGGGAGGCCATG
TTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCACCAGCCGACGACGAACCGTTACCGAACGAGGAC
GACGTCGACGAGATGGACATTGAAGTTCCCGGTTGGTCTGCCAAGGGGGAATGGGTACTCTGGCTTGATCTTCTC
AGTGATATGATCAAGCTCAGCATCTATGTTGCGTTCTTCTTCATGCTTCTCATGTTCTACGGCTTGCCCATACAC
ATCATGAGGGATCTGTTTATGACGTCTCGCGATTTCATCAAGAGGCTAAACGCTCTATTGCGCTATCGCCGAGCC
ATCCAGGAGATGAACAGATACCCAGATGCGTCCGCCGACGACCTCGCGCAGGAGAACACGTGCATCATATGTCGA
GAGGAGATGAGGCCATGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTGCGGCCCAAGAAGTTGCCTTGC
GGCCACATCCTGCACCTCGGTTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGCAGGAGTCCA
GTAACAGCGGCTCGACCTCGCGGCCATCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGAGGCCAGCCG
AGGCTGCAAGGCCAGCAGCCGCCGGCGGATGTCGGCCAACAGGGTCAAGGGAACGGCGATCCACAGCCAAGGCCG
CCAAGAGAAGGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGTTTCGGTACCAACGGCCAGCAGTTC
CGCGAGCTTGCCCAGCAGTTCGGGGTGCCGCACATCGCCGGCAACGAGGCGGCTCCGGCCCCAGCCGCCGAGCAG
AATCAGCCGACGTTGGCCGACAACCTCGGAAGCATCGCCAACCTTCTCCGACAGACGGAGCAACTACTCCAGCGT
GAAGCGCAGCGGATGCACACGGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGACCGAGTTGCTACGCCTA
CAGCAGCGTCGTCTGCAAACAATGGAACAGCCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCCCAGGCTGCC
CATGGCTTGCCGATGAACCCGCCCTTTCCACCAGCCCAACAGTTCGCAGTCCCCACTCTGGGGACACAGCCTCAA
TACCCTGGCATGCCCTTACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTCGGCACATCG
GGTCCCACGGCGCCCATCCCGGCCGGCAGCGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGATGGTCGGTG
GTTCCTCTGCAAAGGCTGGACGGTTCACCGAGTTCGGCCTCGATCCCTCACCCGCCACAGGCGCCCGGGCACGAA
GGAGACGCAGCGACGAACTCAAGCCAGGCAGCCAACGAGGCTCCAGCGTCCGTACCCTTTCCGGTCGGGGGCCAC
TCCGCTCCTCCAGAGCTCGCCGCCGATGAACCCGCTTCGACGGAAGCTCGCCAAGCCGACGAGCCAGCTCCAGTC
GTGGCCCCAAGTCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTACACAACGGTTCCCGCGTCAATCCC
GAAGAACCCAAGCGAAGCACAGTCACGCCAACAACAACAGTCACGAGCGAGCATGCAGACACCGAGGGCGAACAA
GAATCCGCCTCATCATCCAAAGGCAAGGGAAAGGCAGCCACCGTTCAAGACGCCCGCGACGAGGAAGATTGA
Gene >Ophcf2|06098
ATGCGGCTCGGCTGGTACGCTGGGGTACGTATGCCGCGATCTCTGCTTCTATGGCAGTTCTTTGGCTGTTCACCG
CGTTGTTCTTCCAAGGCTTAGGCTAACGGCGGGTCTAGGTCTCCACGGCCCTCGCGGGCGGCGTCGTCATCTCGG
CCTTTCTCCAGCGGGCGAACTTTTATTCGGCCATGGTATATCTGGCTCAGAGCAACTTTTGCTTGCTGGTAAGTT
TATAGGCTCAATACTCTCTGTCCGATGAGACCGCAGAAGCTGACGAGCGGCGGCGCCCTCCTCAGGCCTTGGTCA
ATTTTTCCCTCCTTCTTTACAGTAGCTTCATCTACGGTCTGACGCGCATATGCTTCGGTACGCTGCGCGCTGTCG
AGGTTGAGCAGCTCACAGAGAGAGCATGGTTCGCCATCACGGAAACGTGCCTCGCCATGACCATATTCAGGGAGG
AAATAGGGGCCTGGTTCCTGGTCATGTTCACGGCGTTGGTAACTGGTAAGGTGTGGGGATGGATTGGCGACGGCC
GAGTCGAATTTCTTGAGCAGCAACCGCCTCACAACCCGCGGCTCTTCCACCTTCGACTTAGCATCTCCCTCGGCA
TGAGCTTCCTGTACGATATCCTCATACTGCGATATTCGGTTCGAAACGTCATTCAGCAGGCACGTCCAAACATGA
TGGTCATGTTTCTGTTTGAATTCGCGGTGCTGGCTACGTGCTCATGGCGCACAGGCGCTCGGTACATGCTCGTCT
TGGCGGAACAGAACATCATCAAGACCCAGACTAGGAAGAGGCTGTTTGAAAGAAGACTAGAAGTTCGGGAGCAGC
GGGAGGCCATGTTGCGACGGCGTGAGCAAGCCGCAGCCGCAGGAGAGGACGCACCAGCCGACGACGAACCGTTAC
CGAACGAGGACGACGTCGACGAGATGGACATTGAAGTTCCCGGTTGGTCTGCCAAGGGGGAATGGGTACTCTGGC
TTGATCTTCTCAGTGGTAAGGATCATCCGTCTCTCCAAGCCTCTGCGTGCGCCGCTGACAGTGTCGGCAGATATG
ATCAAGCTCAGCATCTATGTTGCGTTCTTCTTCATGCTTCTCATGTTCTACGGCTTGCCCATACACATCATGAGG
GATCTGTTTATGACGTCTCGCGATTTCATCAAGAGGCTAAACGCTCTATTGCGCTATCGCCGAGCCATCCAGGAG
ATGAACAGATACCCAGATGCGTCCGCCGACGACCTCGCGCAGGAGAACACGTGCATCATATGTCGAGAGGAGATG
AGGCCATGGGATCCGGTTGAAAACCCGGGCGCCATCGATCGGGTGCGGCCCAAGAAGTTGCCTTGCGGCCACATC
CTGCACCTCGGTTGTCTCAAGAGCTGGCTTGAGCGGCAACAGGTGTGTCCCACATGCAGGAGTCCAGTAACAGCG
GCTCGACCTCGCGGCCATCCTGCAGCCGGAGCGGCCGGGCTCAGGATACAGATCGGAGGCCAGCCGAGGCTGCAA
GGCCAGCAGCCGCCGGCGGATGTCGGCCAACAGGGTCAAGGGAACGGCGATCCACAGCCAAGGCCGCCAAGAGAA
GGAGGCCCTCGTATATTCAACATCGGGCCCATCCGGCTTGGTTTCGGTACCAACGGCCAGCAGTTCCGCGAGCTT
GCCCAGCAGTTCGGGGTGCCGCACATCGCCGGCAACGAGGCGGCTCCGGCCCCAGCCGCCGAGCAGAATCAGCCG
ACGTTGGCCGACAACCTCGGAAGCATCGCCAACCTTCTCCGACAGACGGAGCAACTACTCCAGCGTGAAGCGCAG
CGGATGCACACGGCGCAACAGGAGCTTCAGATTGTCAGTCTGCTGATGACCGAGTTGCTACGCCTACAGCAGCGT
CGTCTGCAAACAATGGAACAGCCTCTGGCCGCGCAGCCTCCTCTCCAGCCCTGGCCCCAGGCTGCCCATGGCTTG
CCGATGAACCCGCCCTTTCCACCAGCCCAACAGTTCGCAGTCCCCACTCTGGGGACACAGCCTCAATACCCTGGC
ATGCCCTTACTCCCCGGAGCACCACCTCGCTCAGGGAGCCCGCTGATGGCCCGTCTCGGCACATCGGGTCCCACG
GCGCCCATCCCGGCCGGCAGCGCAGACCTTCCGGAGGGACTGACGCTACCTCCTGGATGGTCGGTGGTTCCTCTG
CAAAGGCTGGACGGTTCACCGAGTTCGGCCTCGATCCCTCACCCGCCACAGGCGCCCGGGCACGAAGGAGACGCA
GCGACGAACTCAAGCCAGGCAGCCAACGAGGCTCCAGCGTCCGTACCCTTTCCGGTCGGGGGCCACTCCGCTCCT
CCAGAGCTCGCCGCCGATGAACCCGCTTCGACGGAAGCTCGCCAAGCCGACGAGCCAGCTCCAGTCGTGGCCCCA
AGTCCCGTGATGCCCAACTGGGCCGGCCCATCGCAGCTACTACACAACGGTTCCCGCGTCAATCCCGAAGAACCC
AAGCGAAGCACAGTCACGCCAACAACAACAGTCACGAGCGAGCATGCAGACACCGAGGGCGAACAAGAATCCGCC
TCATCATCCAAAGGCAAGGGAAAGGCAGCCACCGTTCAAGACGCCCGCGACGAGGAAGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail