Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06096
Gene name
Locationscaffold_07:1227049..1229428
Strand-
Gene length (bp)2379
Transcript length (bp)2379
Coding sequence length (bp)2379
Protein length (aa) 793

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01071 GARS_A Phosphoribosylglycinamide synthetase, ATP-grasp (A) domain 5.4E-79 107 299
PF02844 GARS_N Phosphoribosylglycinamide synthetase, N domain 1.1E-32 5 106
PF02769 AIRS_C AIR synthase related protein, C-terminal domain 5.3E-31 612 773
PF02843 GARS_C Phosphoribosylglycinamide synthetase, C domain 4.2E-27 340 429
PF00586 AIRS AIR synthase related protein, N-terminal domain 3.0E-19 494 598

GO

GO Term Description Terminal node
GO:0004637 phosphoribosylamine-glycine ligase activity Yes
GO:0009113 purine nucleobase biosynthetic process Yes
GO:0008152 metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0009058 biosynthetic process No
GO:0072522 purine-containing compound biosynthetic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0072521 purine-containing compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0009112 nucleobase metabolic process No
GO:0016874 ligase activity No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0008150 biological_process No
GO:0019438 aromatic compound biosynthetic process No
GO:0046112 nucleobase biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0071704 organic substance metabolic process No
GO:0006144 purine nucleobase metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0044281 small molecule metabolic process No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7367 0.3733 0.0289 0.0216 0.2931 0.0225 0.0689 0.2168 0.1483 0.4759

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2434
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6108
Ophiocordyceps australis map64 (Brazil) OphauB2|4592
Ophiocordyceps camponoti-floridani Ophcf2|06096 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3881
Ophiocordyceps kimflemingae Ophio5|5882
Ophiocordyceps subramaniannii Hirsu2|3455

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06096
MIPLRILLIGNGGREHALAWKLSQSRRVDIIFAVPGNGGTATCPKTKNVSTVPVHDFSALVDFALANGVNLVVPG
PEAPLVDGAEAFFRAAKISFFGPSKEAARLEGSKTFSKNFMKQYNIPTAGYQNFSNYAEAVAYIDSIHHDVVIKA
SGLAAGKGVILPQSKEEAKDALRRIMVDKEFGPAGDEVVIEELLVGDELSVLTFSDGDSMVSLPLAQDHKRALEG
DMGPNTGGMGCYAPTNIITADLVRNIDRDILEPTFAGLRREEHPFCGVLFTGIMVTSTGPKVLEYNVRFGDPETQ
TVLPLLPADWDLAVVMVACASGLLCLYNMRLDDFERKFSATVVVAAGGYPGSYAKGTPINVLDPPKGVTIFHAGT
KLEGKQLTTAGGRVMAVNAVADSLETAVKACYSALDSGVIKFDGMFFRRDIAHRAFRKQSAMTYAQAGVDIEAGN
EFVHIIKKAVASTKRPGADAEIGGFGGELDLSRCGCDFKKPPVLVAAIDGVGTKLMVAQSMRTHDTVGIDLVAMN
VNDLIVQGATPLMFLDYYGCSKLDKSSAAAFVQGVADGCRQAGCALVGGETAEMPGMYQGDDYDAAGCAIGAVTA
EGRLPRQDSMIVGDVLLGLASSGVHSNGYSLVRRIVDRAGLDMSAPAPWDTTTTVGVSLLMPTRIYVKSLLPVLD
RVKGLAHITGGGLVDNVPRMLPERLAAEIDFGSWNVPPVFRWLKTAGNVDAVEMSRTFNLGVGMVVAVGANEADD
VTRRLTDGGESVRCIGRLVPRQGQPCVIRYLESWRTPSRLDQ*
Coding >Ophcf2|06096
ATGATACCTCTCCGCATCCTACTCATCGGCAATGGAGGCCGCGAACACGCCCTCGCCTGGAAGCTGAGCCAATCG
CGCCGCGTCGACATCATCTTCGCCGTGCCTGGTAATGGGGGAACCGCAACGTGCCCCAAGACGAAAAACGTCAGC
ACAGTACCGGTTCATGACTTTAGTGCGCTCGTCGACTTTGCCTTAGCAAACGGTGTGAACCTGGTTGTGCCCGGA
CCCGAAGCTCCTCTTGTCGATGGCGCAGAGGCCTTCTTTCGCGCTGCCAAGATATCGTTCTTCGGTCCATCCAAG
GAGGCGGCGCGGCTCGAAGGCAGCAAAACGTTCTCTAAAAACTTCATGAAACAGTACAATATCCCCACGGCCGGG
TATCAAAACTTCTCCAATTACGCCGAGGCCGTCGCCTACATCGACAGCATCCATCATGACGTCGTCATCAAGGCC
TCCGGCTTGGCCGCCGGCAAGGGAGTTATTCTCCCCCAGTCAAAGGAAGAGGCCAAGGATGCCCTGAGACGCATC
ATGGTGGACAAGGAGTTTGGCCCAGCCGGTGACGAGGTCGTCATCGAGGAGCTCCTGGTTGGCGACGAGCTGAGC
GTCCTCACCTTTTCCGACGGCGACAGTATGGTGTCGCTGCCGCTCGCTCAAGACCACAAACGAGCTCTAGAAGGG
GATATGGGCCCTAATACCGGTGGCATGGGCTGCTACGCGCCGACAAACATCATCACCGCCGACCTGGTTCGAAAC
ATCGATCGGGACATTCTCGAACCTACCTTTGCCGGCTTGCGGCGCGAGGAACATCCCTTCTGTGGCGTTCTCTTC
ACTGGTATCATGGTCACATCTACTGGACCCAAGGTTTTAGAATACAATGTGCGATTCGGAGACCCAGAAACACAG
ACGGTGCTGCCGCTGTTGCCAGCCGACTGGGACCTCGCTGTAGTCATGGTCGCTTGCGCCAGTGGCTTACTATGC
CTATACAACATGCGTCTCGATGATTTCGAAAGGAAATTCAGCGCTACCGTCGTCGTGGCCGCCGGGGGCTATCCT
GGCTCGTATGCCAAGGGAACCCCGATTAACGTCCTCGATCCGCCCAAGGGGGTAACCATCTTCCACGCCGGTACC
AAGCTCGAGGGAAAGCAGTTGACGACTGCCGGAGGCCGAGTCATGGCCGTAAACGCCGTGGCCGACTCGCTCGAG
ACTGCAGTCAAGGCGTGTTACTCGGCACTGGACTCGGGCGTCATCAAGTTCGACGGCATGTTCTTCCGGAGAGAC
ATCGCCCATCGTGCCTTTAGAAAACAATCAGCCATGACGTACGCACAAGCTGGCGTCGACATCGAAGCCGGCAAC
GAATTCGTCCATATCATTAAGAAAGCCGTGGCCAGCACCAAGCGGCCCGGGGCCGACGCCGAGATTGGCGGCTTC
GGCGGGGAGCTGGACCTCAGCCGGTGCGGATGTGACTTCAAGAAGCCGCCGGTGCTCGTGGCCGCCATCGATGGT
GTCGGTACGAAGCTGATGGTGGCGCAGTCGATGCGTACACACGACACCGTGGGCATAGACCTGGTAGCCATGAAC
GTCAACGACCTGATCGTCCAAGGCGCAACGCCCCTCATGTTCCTCGACTACTATGGCTGCAGCAAGCTGGACAAG
TCTTCGGCCGCCGCTTTCGTCCAGGGCGTGGCCGACGGCTGTCGTCAGGCTGGCTGCGCCCTGGTGGGCGGCGAA
ACGGCCGAGATGCCGGGCATGTATCAGGGCGACGACTACGACGCTGCCGGTTGCGCCATTGGCGCCGTCACCGCT
GAAGGCCGTCTCCCACGTCAGGACTCCATGATCGTCGGAGACGTTCTACTCGGATTGGCCTCGAGCGGCGTCCAC
TCCAACGGCTACTCACTGGTACGGCGCATCGTCGACCGAGCCGGGCTCGACATGTCGGCTCCCGCGCCCTGGGAC
ACCACTACCACCGTCGGCGTCTCCCTGCTGATGCCGACGCGCATCTACGTCAAGAGCCTTTTGCCCGTCCTCGAC
CGCGTCAAGGGCCTCGCCCACATCACCGGTGGCGGTCTCGTCGATAACGTTCCGCGCATGTTACCGGAGCGTCTC
GCGGCCGAAATCGACTTCGGCTCGTGGAACGTGCCACCAGTCTTCCGCTGGCTCAAGACAGCCGGCAACGTTGAC
GCCGTTGAGATGAGCCGGACGTTTAACCTGGGCGTCGGCATGGTGGTCGCTGTCGGCGCCAACGAAGCCGATGAT
GTCACGCGCCGTCTCACCGACGGCGGTGAATCGGTTCGCTGTATCGGTCGTCTAGTGCCTCGTCAGGGCCAGCCG
TGTGTCATTCGCTACCTGGAGAGCTGGCGAACCCCCAGCAGACTTGACCAATAA
Transcript >Ophcf2|06096
ATGATACCTCTCCGCATCCTACTCATCGGCAATGGAGGCCGCGAACACGCCCTCGCCTGGAAGCTGAGCCAATCG
CGCCGCGTCGACATCATCTTCGCCGTGCCTGGTAATGGGGGAACCGCAACGTGCCCCAAGACGAAAAACGTCAGC
ACAGTACCGGTTCATGACTTTAGTGCGCTCGTCGACTTTGCCTTAGCAAACGGTGTGAACCTGGTTGTGCCCGGA
CCCGAAGCTCCTCTTGTCGATGGCGCAGAGGCCTTCTTTCGCGCTGCCAAGATATCGTTCTTCGGTCCATCCAAG
GAGGCGGCGCGGCTCGAAGGCAGCAAAACGTTCTCTAAAAACTTCATGAAACAGTACAATATCCCCACGGCCGGG
TATCAAAACTTCTCCAATTACGCCGAGGCCGTCGCCTACATCGACAGCATCCATCATGACGTCGTCATCAAGGCC
TCCGGCTTGGCCGCCGGCAAGGGAGTTATTCTCCCCCAGTCAAAGGAAGAGGCCAAGGATGCCCTGAGACGCATC
ATGGTGGACAAGGAGTTTGGCCCAGCCGGTGACGAGGTCGTCATCGAGGAGCTCCTGGTTGGCGACGAGCTGAGC
GTCCTCACCTTTTCCGACGGCGACAGTATGGTGTCGCTGCCGCTCGCTCAAGACCACAAACGAGCTCTAGAAGGG
GATATGGGCCCTAATACCGGTGGCATGGGCTGCTACGCGCCGACAAACATCATCACCGCCGACCTGGTTCGAAAC
ATCGATCGGGACATTCTCGAACCTACCTTTGCCGGCTTGCGGCGCGAGGAACATCCCTTCTGTGGCGTTCTCTTC
ACTGGTATCATGGTCACATCTACTGGACCCAAGGTTTTAGAATACAATGTGCGATTCGGAGACCCAGAAACACAG
ACGGTGCTGCCGCTGTTGCCAGCCGACTGGGACCTCGCTGTAGTCATGGTCGCTTGCGCCAGTGGCTTACTATGC
CTATACAACATGCGTCTCGATGATTTCGAAAGGAAATTCAGCGCTACCGTCGTCGTGGCCGCCGGGGGCTATCCT
GGCTCGTATGCCAAGGGAACCCCGATTAACGTCCTCGATCCGCCCAAGGGGGTAACCATCTTCCACGCCGGTACC
AAGCTCGAGGGAAAGCAGTTGACGACTGCCGGAGGCCGAGTCATGGCCGTAAACGCCGTGGCCGACTCGCTCGAG
ACTGCAGTCAAGGCGTGTTACTCGGCACTGGACTCGGGCGTCATCAAGTTCGACGGCATGTTCTTCCGGAGAGAC
ATCGCCCATCGTGCCTTTAGAAAACAATCAGCCATGACGTACGCACAAGCTGGCGTCGACATCGAAGCCGGCAAC
GAATTCGTCCATATCATTAAGAAAGCCGTGGCCAGCACCAAGCGGCCCGGGGCCGACGCCGAGATTGGCGGCTTC
GGCGGGGAGCTGGACCTCAGCCGGTGCGGATGTGACTTCAAGAAGCCGCCGGTGCTCGTGGCCGCCATCGATGGT
GTCGGTACGAAGCTGATGGTGGCGCAGTCGATGCGTACACACGACACCGTGGGCATAGACCTGGTAGCCATGAAC
GTCAACGACCTGATCGTCCAAGGCGCAACGCCCCTCATGTTCCTCGACTACTATGGCTGCAGCAAGCTGGACAAG
TCTTCGGCCGCCGCTTTCGTCCAGGGCGTGGCCGACGGCTGTCGTCAGGCTGGCTGCGCCCTGGTGGGCGGCGAA
ACGGCCGAGATGCCGGGCATGTATCAGGGCGACGACTACGACGCTGCCGGTTGCGCCATTGGCGCCGTCACCGCT
GAAGGCCGTCTCCCACGTCAGGACTCCATGATCGTCGGAGACGTTCTACTCGGATTGGCCTCGAGCGGCGTCCAC
TCCAACGGCTACTCACTGGTACGGCGCATCGTCGACCGAGCCGGGCTCGACATGTCGGCTCCCGCGCCCTGGGAC
ACCACTACCACCGTCGGCGTCTCCCTGCTGATGCCGACGCGCATCTACGTCAAGAGCCTTTTGCCCGTCCTCGAC
CGCGTCAAGGGCCTCGCCCACATCACCGGTGGCGGTCTCGTCGATAACGTTCCGCGCATGTTACCGGAGCGTCTC
GCGGCCGAAATCGACTTCGGCTCGTGGAACGTGCCACCAGTCTTCCGCTGGCTCAAGACAGCCGGCAACGTTGAC
GCCGTTGAGATGAGCCGGACGTTTAACCTGGGCGTCGGCATGGTGGTCGCTGTCGGCGCCAACGAAGCCGATGAT
GTCACGCGCCGTCTCACCGACGGCGGTGAATCGGTTCGCTGTATCGGTCGTCTAGTGCCTCGTCAGGGCCAGCCG
TGTGTCATTCGCTACCTGGAGAGCTGGCGAACCCCCAGCAGACTTGACCAATAA
Gene >Ophcf2|06096
ATGATACCTCTCCGCATCCTACTCATCGGCAATGGAGGCCGCGAACACGCCCTCGCCTGGAAGCTGAGCCAATCG
CGCCGCGTCGACATCATCTTCGCCGTGCCTGGTAATGGGGGAACCGCAACGTGCCCCAAGACGAAAAACGTCAGC
ACAGTACCGGTTCATGACTTTAGTGCGCTCGTCGACTTTGCCTTAGCAAACGGTGTGAACCTGGTTGTGCCCGGA
CCCGAAGCTCCTCTTGTCGATGGCGCAGAGGCCTTCTTTCGCGCTGCCAAGATATCGTTCTTCGGTCCATCCAAG
GAGGCGGCGCGGCTCGAAGGCAGCAAAACGTTCTCTAAAAACTTCATGAAACAGTACAATATCCCCACGGCCGGG
TATCAAAACTTCTCCAATTACGCCGAGGCCGTCGCCTACATCGACAGCATCCATCATGACGTCGTCATCAAGGCC
TCCGGCTTGGCCGCCGGCAAGGGAGTTATTCTCCCCCAGTCAAAGGAAGAGGCCAAGGATGCCCTGAGACGCATC
ATGGTGGACAAGGAGTTTGGCCCAGCCGGTGACGAGGTCGTCATCGAGGAGCTCCTGGTTGGCGACGAGCTGAGC
GTCCTCACCTTTTCCGACGGCGACAGTATGGTGTCGCTGCCGCTCGCTCAAGACCACAAACGAGCTCTAGAAGGG
GATATGGGCCCTAATACCGGTGGCATGGGCTGCTACGCGCCGACAAACATCATCACCGCCGACCTGGTTCGAAAC
ATCGATCGGGACATTCTCGAACCTACCTTTGCCGGCTTGCGGCGCGAGGAACATCCCTTCTGTGGCGTTCTCTTC
ACTGGTATCATGGTCACATCTACTGGACCCAAGGTTTTAGAATACAATGTGCGATTCGGAGACCCAGAAACACAG
ACGGTGCTGCCGCTGTTGCCAGCCGACTGGGACCTCGCTGTAGTCATGGTCGCTTGCGCCAGTGGCTTACTATGC
CTATACAACATGCGTCTCGATGATTTCGAAAGGAAATTCAGCGCTACCGTCGTCGTGGCCGCCGGGGGCTATCCT
GGCTCGTATGCCAAGGGAACCCCGATTAACGTCCTCGATCCGCCCAAGGGGGTAACCATCTTCCACGCCGGTACC
AAGCTCGAGGGAAAGCAGTTGACGACTGCCGGAGGCCGAGTCATGGCCGTAAACGCCGTGGCCGACTCGCTCGAG
ACTGCAGTCAAGGCGTGTTACTCGGCACTGGACTCGGGCGTCATCAAGTTCGACGGCATGTTCTTCCGGAGAGAC
ATCGCCCATCGTGCCTTTAGAAAACAATCAGCCATGACGTACGCACAAGCTGGCGTCGACATCGAAGCCGGCAAC
GAATTCGTCCATATCATTAAGAAAGCCGTGGCCAGCACCAAGCGGCCCGGGGCCGACGCCGAGATTGGCGGCTTC
GGCGGGGAGCTGGACCTCAGCCGGTGCGGATGTGACTTCAAGAAGCCGCCGGTGCTCGTGGCCGCCATCGATGGT
GTCGGTACGAAGCTGATGGTGGCGCAGTCGATGCGTACACACGACACCGTGGGCATAGACCTGGTAGCCATGAAC
GTCAACGACCTGATCGTCCAAGGCGCAACGCCCCTCATGTTCCTCGACTACTATGGCTGCAGCAAGCTGGACAAG
TCTTCGGCCGCCGCTTTCGTCCAGGGCGTGGCCGACGGCTGTCGTCAGGCTGGCTGCGCCCTGGTGGGCGGCGAA
ACGGCCGAGATGCCGGGCATGTATCAGGGCGACGACTACGACGCTGCCGGTTGCGCCATTGGCGCCGTCACCGCT
GAAGGCCGTCTCCCACGTCAGGACTCCATGATCGTCGGAGACGTTCTACTCGGATTGGCCTCGAGCGGCGTCCAC
TCCAACGGCTACTCACTGGTACGGCGCATCGTCGACCGAGCCGGGCTCGACATGTCGGCTCCCGCGCCCTGGGAC
ACCACTACCACCGTCGGCGTCTCCCTGCTGATGCCGACGCGCATCTACGTCAAGAGCCTTTTGCCCGTCCTCGAC
CGCGTCAAGGGCCTCGCCCACATCACCGGTGGCGGTCTCGTCGATAACGTTCCGCGCATGTTACCGGAGCGTCTC
GCGGCCGAAATCGACTTCGGCTCGTGGAACGTGCCACCAGTCTTCCGCTGGCTCAAGACAGCCGGCAACGTTGAC
GCCGTTGAGATGAGCCGGACGTTTAACCTGGGCGTCGGCATGGTGGTCGCTGTCGGCGCCAACGAAGCCGATGAT
GTCACGCGCCGTCTCACCGACGGCGGTGAATCGGTTCGCTGTATCGGTCGTCTAGTGCCTCGTCAGGGCCAGCCG
TGTGTCATTCGCTACCTGGAGAGCTGGCGAACCCCCAGCAGACTTGACCAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail