Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06094
Gene name
Locationscaffold_07:1223553..1224516
Strand+
Gene length (bp)963
Transcript length (bp)909
Coding sequence length (bp)909
Protein length (aa) 303

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12146 Hydrolase_4 Serine aminopeptidase, S33 5.7E-52 27 276
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.3E-15 31 284
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 4.3E-11 31 144

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Mitochondrion Peroxisomal targeting signal 0.4521 0.1633 0.3869 0.0342 0.5249 0.0258 0.3413 0.2172 0.1943 0.5156

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5455
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7910
Ophiocordyceps australis map64 (Brazil) OphauB2|4253
Ophiocordyceps camponoti-floridani Ophcf2|06094 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3879
Ophiocordyceps kimflemingae Ophio5|222
Ophiocordyceps subramaniannii Hirsu2|6202

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06094
MASIDESTFEHGDSSFYSKTWTPHGAIKAKLVFVHGFSEHINRYNDFFPKLAKHGIQVLSWDQRGWGRSASKSWQ
KGRTGPTAEVIADVAAFVREKLVESDEASRVPVFVMGHSMGGGQVLTLAGDDNYADLVGRVRGWILESPFVGFPP
GGEPSSVTVFAGRLMGRLLPKQQMKHAVAAELLTRDLDIVKSVRDDPLCHDTGTLEGLASMLDRAENLSSGRVRL
GKHVRSVLLTHGTKDMVCCCDAAVRFVDGQDAVEDKTWKLYDGAYHQLHTDHCKDDFARDVAEWILKRSDEQVEA
KL*
Coding >Ophcf2|06094
ATGGCGAGCATTGACGAGTCGACCTTTGAGCATGGAGATTCCAGCTTCTACTCCAAGACGTGGACGCCACACGGC
GCCATCAAGGCCAAGCTGGTATTCGTGCACGGCTTCAGCGAGCACATCAACCGCTATAACGATTTCTTCCCCAAG
CTGGCCAAACACGGCATCCAGGTACTGTCCTGGGATCAGCGCGGATGGGGCCGCAGCGCAAGCAAGTCGTGGCAG
AAGGGCCGGACGGGTCCGACAGCCGAGGTGATTGCCGACGTGGCAGCCTTTGTGCGCGAAAAGCTGGTGGAATCG
GACGAAGCGTCGCGGGTGCCCGTCTTCGTCATGGGCCACTCCATGGGCGGAGGCCAGGTTCTGACGCTGGCGGGT
GACGATAACTACGCTGACCTGGTGGGACGCGTGCGAGGCTGGATACTCGAGAGCCCCTTTGTTGGCTTCCCTCCA
GGCGGAGAGCCCAGCAGCGTGACCGTCTTCGCTGGCCGGCTCATGGGCCGACTTCTACCCAAGCAGCAGATGAAG
CACGCCGTGGCAGCCGAGTTGCTAACGCGAGACCTGGACATCGTCAAGTCTGTGCGCGACGACCCTCTATGCCAC
GACACGGGTACGCTCGAAGGACTCGCCTCGATGTTGGACCGAGCAGAGAACCTCTCCTCCGGCCGAGTCCGGCTC
GGGAAGCACGTGCGCAGCGTGCTGCTGACGCATGGAACAAAGGACATGGTTTGCTGCTGCGACGCGGCTGTTCGG
TTCGTCGATGGCCAGGATGCTGTTGAGGATAAGACGTGGAAGCTGTATGACGGCGCGTATCATCAGCTTCATACT
GATCACTGTAAGGATGATTTTGCGAGGGATGTGGCTGAGTGGATCTTGAAGCGGAGTGATGAGCAGGTCGAGGCC
AAGTTGTGA
Transcript >Ophcf2|06094
ATGGCGAGCATTGACGAGTCGACCTTTGAGCATGGAGATTCCAGCTTCTACTCCAAGACGTGGACGCCACACGGC
GCCATCAAGGCCAAGCTGGTATTCGTGCACGGCTTCAGCGAGCACATCAACCGCTATAACGATTTCTTCCCCAAG
CTGGCCAAACACGGCATCCAGGTACTGTCCTGGGATCAGCGCGGATGGGGCCGCAGCGCAAGCAAGTCGTGGCAG
AAGGGCCGGACGGGTCCGACAGCCGAGGTGATTGCCGACGTGGCAGCCTTTGTGCGCGAAAAGCTGGTGGAATCG
GACGAAGCGTCGCGGGTGCCCGTCTTCGTCATGGGCCACTCCATGGGCGGAGGCCAGGTTCTGACGCTGGCGGGT
GACGATAACTACGCTGACCTGGTGGGACGCGTGCGAGGCTGGATACTCGAGAGCCCCTTTGTTGGCTTCCCTCCA
GGCGGAGAGCCCAGCAGCGTGACCGTCTTCGCTGGCCGGCTCATGGGCCGACTTCTACCCAAGCAGCAGATGAAG
CACGCCGTGGCAGCCGAGTTGCTAACGCGAGACCTGGACATCGTCAAGTCTGTGCGCGACGACCCTCTATGCCAC
GACACGGGTACGCTCGAAGGACTCGCCTCGATGTTGGACCGAGCAGAGAACCTCTCCTCCGGCCGAGTCCGGCTC
GGGAAGCACGTGCGCAGCGTGCTGCTGACGCATGGAACAAAGGACATGGTTTGCTGCTGCGACGCGGCTGTTCGG
TTCGTCGATGGCCAGGATGCTGTTGAGGATAAGACGTGGAAGCTGTATGACGGCGCGTATCATCAGCTTCATACT
GATCACTGTAAGGATGATTTTGCGAGGGATGTGGCTGAGTGGATCTTGAAGCGGAGTGATGAGCAGGTCGAGGCC
AAGTTGTGA
Gene >Ophcf2|06094
ATGGCGAGCATTGACGAGTCGACCTTTGAGCATGGAGATTCCAGCTTCTACTCCAAGACGTGGACGGTGAGTGGA
AGCGAGAACGTTGACAGCTGTGGACGGCGCTGATGCCCAATTCAGCCACACGGCGCCATCAAGGCCAAGCTGGTA
TTCGTGCACGGCTTCAGCGAGCACATCAACCGCTATAACGATTTCTTCCCCAAGCTGGCCAAACACGGCATCCAG
GTACTGTCCTGGGATCAGCGCGGATGGGGCCGCAGCGCAAGCAAGTCGTGGCAGAAGGGCCGGACGGGTCCGACA
GCCGAGGTGATTGCCGACGTGGCAGCCTTTGTGCGCGAAAAGCTGGTGGAATCGGACGAAGCGTCGCGGGTGCCC
GTCTTCGTCATGGGCCACTCCATGGGCGGAGGCCAGGTTCTGACGCTGGCGGGTGACGATAACTACGCTGACCTG
GTGGGACGCGTGCGAGGCTGGATACTCGAGAGCCCCTTTGTTGGCTTCCCTCCAGGCGGAGAGCCCAGCAGCGTG
ACCGTCTTCGCTGGCCGGCTCATGGGCCGACTTCTACCCAAGCAGCAGATGAAGCACGCCGTGGCAGCCGAGTTG
CTAACGCGAGACCTGGACATCGTCAAGTCTGTGCGCGACGACCCTCTATGCCACGACACGGGTACGCTCGAAGGA
CTCGCCTCGATGTTGGACCGAGCAGAGAACCTCTCCTCCGGCCGAGTCCGGCTCGGGAAGCACGTGCGCAGCGTG
CTGCTGACGCATGGAACAAAGGACATGGTTTGCTGCTGCGACGCGGCTGTTCGGTTCGTCGATGGCCAGGATGCT
GTTGAGGATAAGACGTGGAAGCTGTATGACGGCGCGTATCATCAGCTTCATACTGATCACTGTAAGGATGATTTT
GCGAGGGATGTGGCTGAGTGGATCTTGAAGCGGAGTGATGAGCAGGTCGAGGCCAAGTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail