Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06093
Gene name
Locationscaffold_07:1218979..1222928
Strand+
Gene length (bp)3949
Transcript length (bp)2526
Coding sequence length (bp)2526
Protein length (aa) 842

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00664 ABC_membrane ABC transporter transmembrane region 9.9E-52 224 495
PF00036 EF-hand_1 EF hand 1.3E-08 12 40
PF00036 EF-hand_1 EF hand 1.5E-07 48 75
PF00036 EF-hand_1 EF hand 2.8E-08 85 112
PF00036 EF-hand_1 EF hand 9.8E-08 121 146
PF00005 ABC_tran ABC transporter 7.9E-33 564 711
PF13499 EF-hand_7 EF-hand domain pair 4.2E-14 13 73
PF13499 EF-hand_7 EF-hand domain pair 6.1E-17 83 144
PF13833 EF-hand_8 EF-hand domain pair 1.0E-11 25 75
PF13833 EF-hand_8 EF-hand domain pair 3.3E-02 82 105
PF13833 EF-hand_8 EF-hand domain pair 3.0E-13 98 147
PF13405 EF-hand_6 EF-hand domain 1.1E-07 12 41
PF13405 EF-hand_6 EF-hand domain 1.5E-07 85 114
PF13202 EF-hand_5 EF hand 2.3E-05 14 37
PF13202 EF-hand_5 EF hand 2.2E-03 49 73
PF13202 EF-hand_5 EF hand 1.4E-04 86 110
PF13202 EF-hand_5 EF hand 3.6E-03 124 142

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0005509 calcium ion binding Yes
GO:0140359 ABC-type transporter activity Yes
GO:0022857 transmembrane transporter activity No
GO:0005215 transporter activity No
GO:0022804 active transmembrane transporter activity No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0031224 intrinsic component of membrane No
GO:0043169 cation binding No
GO:0140657 ATP-dependent activity No
GO:1901363 heterocyclic compound binding No
GO:0043168 anion binding No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0110165 cellular anatomical entity No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0030554 adenyl nucleotide binding No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0015399 primary active transmembrane transporter activity No
GO:0036094 small molecule binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No
GO:0042626 ATPase-coupled transmembrane transporter activity No
GO:0017076 purine nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0046872 metal ion binding No
GO:0051179 localization No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 69 0.45

Transmembrane Domains

Domain # Start End Length
1 222 244 22
2 269 291 22
3 348 365 17
4 369 391 22
5 454 476 22
6 486 508 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06093
MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADNNGTIDFPEFLTMMAR
KMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDDEVDEMIREADQDGDGRIDYNEFVHQLQQTK
TNERDEQSVKSDQVLPSPRDEEGLEFKKSEKAAKAAQVNLSAKLSKEGKTQSNAGFGEIWRLVKVASPEIRWLAV
AFFFLVIGSSVTMLIPFSVGRILDLASKGDSDDVRVFGLTLNQFFMGLGAILTLGAMANFGRIVLLRIVGERVVA
RLRSQLYRRTYVQDAEFFDANRVGDLISRLSSDTVIVGKSVTQNLSDGLRSLFSGGAGFAIMVWTSAKLTGLLLL
MFPPIAVGAFFYGRAIRNISRALQKNLGSLTKIAEERLGNIKTSQAFVGEVQEVGRYNKQIRRIFALGKKESLTA
ATFFASTGWAGNMTILAMLIVGGSFVRSGEMSIGDLTSFMMYTAFAGSSLFGLSGFYSELMKGVGAASRLFELQD
RKPGIHQTVGLRVTSAQGPIRFSDVVFAYPTRPAVKIFNGLNFEIPSGSNVCVVGPSGGGKSTVAALLLRFYKAT
SGSITINGVDISKMNVKSLRRRIGVVSQEPVLFSGSIAENIAYGNPMALRAEIVSAARRANCNFISDLPDGLETQ
VGARGSQLSGGQKQRIAIARALLKDPDILILDEATSALDAESETLVNEALAGLLRGRNTTISIAHRLSTIKRSDQ
IIVLNTEGKVAEIGSYAKLAVDKQSAFTKLMEWQMSGGDIPEKRSSDSGPHFTEAEEMEQEFDLEDDEGPDEDQK
GGKQPWRPDDDEGRRR*
Coding >Ophcf2|06093
ATGGCTGATTCCCTCACCGAGGAGCAGGTTTCCGAGTTTAAGGAGGCTTTCTCTCTCTTTGATAAGGATGGCGAT
GGTCAGATCACCACCAAGGAGCTGGGTACCGTCATGCGCTCTCTTGGCCAGAACCCTTCAGAGTCTGAGCTCCAA
GACATGATCAACGAAGTTGATGCCGACAACAACGGTACCATCGATTTTCCAGAATTCTTGACTATGATGGCTCGG
AAAATGAAGGATACAGACTCTGAAGAAGAGATCCGAGAAGCTTTCAAGGTCTTCGATCGTGATAACAACGGCTTT
ATCTCTGCGGCGGAGCTGCGTCACGTCATGACGTCAATTGGCGAGAAACTGACCGATGACGAAGTTGACGAGATG
ATCCGTGAAGCCGACCAGGACGGCGATGGTCGGATTGACTACAACGAATTTGTCCACCAGCTACAGCAAACCAAG
ACGAATGAGAGGGACGAACAATCGGTCAAGTCCGATCAAGTGCTGCCGTCCCCCCGAGACGAAGAGGGTCTGGAG
TTTAAGAAGAGCGAGAAGGCGGCAAAGGCAGCTCAAGTCAACTTGTCTGCCAAGCTGTCCAAGGAGGGCAAGACA
CAGAGCAATGCCGGTTTCGGGGAGATTTGGAGGCTTGTTAAAGTCGCCAGTCCCGAGATCAGATGGCTGGCCGTT
GCCTTTTTCTTTCTCGTCATTGGTTCCAGCGTTACCATGTTGATTCCCTTCTCCGTCGGCCGGATCCTGGACCTT
GCCTCGAAAGGTGACAGCGACGATGTCCGTGTCTTCGGCCTGACGCTGAACCAGTTCTTCATGGGCCTCGGTGCG
ATCCTGACTCTGGGTGCCATGGCCAACTTTGGACGGATCGTCTTGCTGCGCATTGTGGGTGAGAGAGTCGTGGCT
CGGTTGCGATCTCAGCTGTACAGACGCACCTACGTTCAAGACGCAGAGTTTTTCGATGCCAACAGGGTGGGAGAC
CTGATTTCGCGCCTCAGCTCCGATACGGTCATCGTTGGGAAATCGGTCACGCAGAACTTGAGCGACGGCCTTCGA
TCCCTGTTTAGTGGCGGTGCCGGATTCGCCATCATGGTCTGGACCAGCGCCAAACTCACTGGGCTGCTGCTGCTC
ATGTTCCCTCCCATTGCCGTTGGGGCTTTCTTCTACGGTCGGGCCATCAGAAACATTAGCAGAGCCCTGCAGAAG
AACCTTGGATCGCTGACGAAAATCGCCGAAGAACGGTTGGGCAACATCAAGACGAGTCAAGCGTTCGTTGGAGAG
GTCCAAGAGGTCGGGCGCTACAACAAACAGATTCGACGCATCTTTGCGCTTGGAAAAAAGGAATCGCTCACCGCG
GCAACTTTCTTTGCCTCCACTGGATGGGCCGGGAACATGACGATTCTGGCCATGCTCATCGTTGGCGGCAGCTTC
GTGCGATCCGGCGAGATGTCTATTGGCGACCTCACGTCGTTTATGATGTATACGGCCTTTGCCGGCTCCAGCTTA
TTCGGCCTGTCGGGCTTCTACTCGGAGCTGATGAAGGGCGTAGGCGCTGCCAGCCGACTGTTTGAGCTGCAAGAC
CGCAAGCCGGGAATTCACCAGACGGTCGGCCTCCGGGTCACATCAGCTCAGGGTCCTATTCGATTCAGTGACGTT
GTTTTTGCCTATCCGACTCGGCCGGCGGTAAAGATCTTCAACGGGCTGAACTTTGAGATACCGTCGGGCAGCAAC
GTCTGCGTTGTTGGGCCTTCCGGAGGCGGCAAGTCTACGGTGGCCGCCTTACTGCTGAGATTCTACAAGGCAACT
TCGGGCAGTATTACCATCAACGGCGTCGACATCTCGAAAATGAATGTCAAATCACTGAGGCGACGGATTGGAGTG
GTGTCTCAGGAGCCTGTGCTCTTCTCTGGATCCATCGCCGAGAACATTGCGTACGGAAACCCCATGGCGCTGCGG
GCGGAAATCGTGTCGGCCGCCAGGCGGGCCAATTGCAATTTCATCAGCGACCTTCCGGACGGCCTCGAGACCCAG
GTCGGAGCCAGGGGGTCTCAGTTGTCAGGCGGGCAGAAGCAGCGGATCGCCATTGCCCGGGCACTTCTCAAGGAT
CCGGATATTCTGATCCTCGACGAGGCCACGTCGGCGCTGGATGCTGAATCGGAAACGCTGGTGAACGAAGCCTTG
GCAGGGCTGCTGCGCGGTCGCAATACGACGATATCCATCGCTCATCGGCTGTCGACAATCAAGCGATCGGATCAA
ATCATTGTCCTCAACACCGAGGGCAAAGTAGCTGAGATTGGCAGTTACGCTAAGCTTGCGGTCGACAAACAAAGC
GCCTTTACCAAGCTGATGGAGTGGCAGATGAGCGGAGGAGACATTCCCGAAAAGAGAAGCTCTGATTCTGGTCCT
CACTTCACTGAGGCGGAAGAGATGGAGCAAGAATTTGACCTCGAGGACGACGAAGGGCCTGACGAGGACCAAAAG
GGGGGAAAGCAACCTTGGCGGCCTGACGATGATGAGGGCCGGCGGCGTTAA
Transcript >Ophcf2|06093
ATGGCTGATTCCCTCACCGAGGAGCAGGTTTCCGAGTTTAAGGAGGCTTTCTCTCTCTTTGATAAGGATGGCGAT
GGTCAGATCACCACCAAGGAGCTGGGTACCGTCATGCGCTCTCTTGGCCAGAACCCTTCAGAGTCTGAGCTCCAA
GACATGATCAACGAAGTTGATGCCGACAACAACGGTACCATCGATTTTCCAGAATTCTTGACTATGATGGCTCGG
AAAATGAAGGATACAGACTCTGAAGAAGAGATCCGAGAAGCTTTCAAGGTCTTCGATCGTGATAACAACGGCTTT
ATCTCTGCGGCGGAGCTGCGTCACGTCATGACGTCAATTGGCGAGAAACTGACCGATGACGAAGTTGACGAGATG
ATCCGTGAAGCCGACCAGGACGGCGATGGTCGGATTGACTACAACGAATTTGTCCACCAGCTACAGCAAACCAAG
ACGAATGAGAGGGACGAACAATCGGTCAAGTCCGATCAAGTGCTGCCGTCCCCCCGAGACGAAGAGGGTCTGGAG
TTTAAGAAGAGCGAGAAGGCGGCAAAGGCAGCTCAAGTCAACTTGTCTGCCAAGCTGTCCAAGGAGGGCAAGACA
CAGAGCAATGCCGGTTTCGGGGAGATTTGGAGGCTTGTTAAAGTCGCCAGTCCCGAGATCAGATGGCTGGCCGTT
GCCTTTTTCTTTCTCGTCATTGGTTCCAGCGTTACCATGTTGATTCCCTTCTCCGTCGGCCGGATCCTGGACCTT
GCCTCGAAAGGTGACAGCGACGATGTCCGTGTCTTCGGCCTGACGCTGAACCAGTTCTTCATGGGCCTCGGTGCG
ATCCTGACTCTGGGTGCCATGGCCAACTTTGGACGGATCGTCTTGCTGCGCATTGTGGGTGAGAGAGTCGTGGCT
CGGTTGCGATCTCAGCTGTACAGACGCACCTACGTTCAAGACGCAGAGTTTTTCGATGCCAACAGGGTGGGAGAC
CTGATTTCGCGCCTCAGCTCCGATACGGTCATCGTTGGGAAATCGGTCACGCAGAACTTGAGCGACGGCCTTCGA
TCCCTGTTTAGTGGCGGTGCCGGATTCGCCATCATGGTCTGGACCAGCGCCAAACTCACTGGGCTGCTGCTGCTC
ATGTTCCCTCCCATTGCCGTTGGGGCTTTCTTCTACGGTCGGGCCATCAGAAACATTAGCAGAGCCCTGCAGAAG
AACCTTGGATCGCTGACGAAAATCGCCGAAGAACGGTTGGGCAACATCAAGACGAGTCAAGCGTTCGTTGGAGAG
GTCCAAGAGGTCGGGCGCTACAACAAACAGATTCGACGCATCTTTGCGCTTGGAAAAAAGGAATCGCTCACCGCG
GCAACTTTCTTTGCCTCCACTGGATGGGCCGGGAACATGACGATTCTGGCCATGCTCATCGTTGGCGGCAGCTTC
GTGCGATCCGGCGAGATGTCTATTGGCGACCTCACGTCGTTTATGATGTATACGGCCTTTGCCGGCTCCAGCTTA
TTCGGCCTGTCGGGCTTCTACTCGGAGCTGATGAAGGGCGTAGGCGCTGCCAGCCGACTGTTTGAGCTGCAAGAC
CGCAAGCCGGGAATTCACCAGACGGTCGGCCTCCGGGTCACATCAGCTCAGGGTCCTATTCGATTCAGTGACGTT
GTTTTTGCCTATCCGACTCGGCCGGCGGTAAAGATCTTCAACGGGCTGAACTTTGAGATACCGTCGGGCAGCAAC
GTCTGCGTTGTTGGGCCTTCCGGAGGCGGCAAGTCTACGGTGGCCGCCTTACTGCTGAGATTCTACAAGGCAACT
TCGGGCAGTATTACCATCAACGGCGTCGACATCTCGAAAATGAATGTCAAATCACTGAGGCGACGGATTGGAGTG
GTGTCTCAGGAGCCTGTGCTCTTCTCTGGATCCATCGCCGAGAACATTGCGTACGGAAACCCCATGGCGCTGCGG
GCGGAAATCGTGTCGGCCGCCAGGCGGGCCAATTGCAATTTCATCAGCGACCTTCCGGACGGCCTCGAGACCCAG
GTCGGAGCCAGGGGGTCTCAGTTGTCAGGCGGGCAGAAGCAGCGGATCGCCATTGCCCGGGCACTTCTCAAGGAT
CCGGATATTCTGATCCTCGACGAGGCCACGTCGGCGCTGGATGCTGAATCGGAAACGCTGGTGAACGAAGCCTTG
GCAGGGCTGCTGCGCGGTCGCAATACGACGATATCCATCGCTCATCGGCTGTCGACAATCAAGCGATCGGATCAA
ATCATTGTCCTCAACACCGAGGGCAAAGTAGCTGAGATTGGCAGTTACGCTAAGCTTGCGGTCGACAAACAAAGC
GCCTTTACCAAGCTGATGGAGTGGCAGATGAGCGGAGGAGACATTCCCGAAAAGAGAAGCTCTGATTCTGGTCCT
CACTTCACTGAGGCGGAAGAGATGGAGCAAGAATTTGACCTCGAGGACGACGAAGGGCCTGACGAGGACCAAAAG
GGGGGAAAGCAACCTTGGCGGCCTGACGATGATGAGGGCCGGCGGCGTTAA
Gene >Ophcf2|06093
ATGGTCAGTGAATAATTCCTTTATAGTTCCCTGCCTACCCCAGTCCGTCGTCTTCGCTACCGTCACTTGCCGCGC
AACCATGAGAGACTTCCGAGGAGGGGCGGCCCGGGCGCAATGTGGTATTATTGCTGACACTCTCCCGCCCGACAG
GCTGATTCCCTCACCGAGGAGCAGGTTTCCGAGTTTAAGGAGGCTTTCTCTCTCTTTGTGAGTAGACCTCTGTTT
CCAAACCTCTCGCTACCATCGCCGACTGACGTTCATCGGTCTTCTAGGATAAGGATGGCGATGGTGAGTCGCTTT
CCGACCTTCCCGCACGCTCTCCTATACCCGAAGACAACATGGCAAATATTCAACTCAGCATCGCGACTGCGACTG
ATTACTTGGCAGGTCAGATCACCACCAAGGAGCTGGGTACCGTCATGCGCTCTCTTGGCCAGAACCCTTCAGAGT
CTGAGCTCCAAGACATGATCAACGAAGTTGATGCCGACAACAACGGTACCATCGATTTTCCAGGTGCGTTGAAAC
GCCATGGACCTTATGGCTGTTCCAGGCTGACTTGGCCATGAAGAATTCTTGACTATGATGGCTCGGAAAATGAAG
GATACAGACTCTGAAGAAGAGATCCGAGAAGCTTTCAAGGTCGGTGAAGCGACGGACTACAAGAAATCGTGCAGC
TGACAAGCTCAGGTCTTCGATCGTGATAACAACGGCTTTATCTCTGCGGCGGAGCTGCGTCACGTCATGACGTCA
ATTGGCGAGAAACTGACCGATGACGAAGTTGACGAGATGATCCGTGAAGCCGACCAGGACGGCGATGGTCGGATT
GACTGTAGGGCCTTTTTCCCCGACGCTTGTTGAGAAAATGCTAACTTGAGAAAGACAACGAATTTGTCCAGTTGA
TGATGCAAAAGTGAAGCAAGCTTTCCTACAGCCTGCGCGTCCGTCTGCTCCGTTAAACCATACAAAACATAGTCA
CACCGATCTTTGTCCGCGGTGTCATTTTAAACCCTTCCTACGACTCGAAGCGGTGGGGTGCAACGTCCGGGAGAG
GCAAGTCGAATATTTACCATGTCTGTTATTGTTCTGGCGCGTTCGCAGGCGATCCTGGTAGCCGACGGAAATCAG
GGCCGATAATGTGAGGAAGCGCCTGCGTTAAGACTCTGTATGTTTCTTGCCAAGTCTTTTGGAGTCTGGTCCACG
TGCATCTGAAATGATTGGTGTAGTCCAGCTACTGGTGAACCATGTTGGTTGCGAAATGCAGACTGTTGCATGCTT
TTTTCATGTCGCCTTTCCACGATGCTGGCAGCTGATGGTGGTGGATTGACTGCGCATGACTAAGCTTTTGGAGTG
GCCTGCACCTCGCTCGAGATGATCCGAATCCCGGCCTGACACTGCCAGAGCGAAATCTTTGCCGTAGAGACCTTG
TCACTGCCCGCTGCAACACCGCAGCCACCGCCCTGGCACCTAGGTATTTGCTGTTGGGTATTCTTTTACAGTCAG
GCTCAATCTCCCTTACCGCCTTGAAAGGGCCGATGATGCTCCTTAGACTCGTCGCCATCCAGTGCGCCATTCTTT
TAACATGATATCGGCCGCGGCCCGGCGAGCGCTGCTAGTGGAGGGTCTTCCTGTGTCGACCAGAACCTCTCCATG
CAGCCTCAAAGCTCCTTTATCGCAAGCTCGAAGCCTCTTTGCGCCAACAGCATCCTCAACGGGTCGCGAAACGCT
GTCGCTGTCGCCAATCTGGCACCGCGCTGGCTGTGATGCCGCGTATCCCCGGCTTGGGCGGCCGTTGTGTCCCAT
TACGCTCGGGGTAGCCTCGGGCGCTCTCCGACGGTTCTCACGGAGTCCACTCAGCCAGCTACAGCAAACCAAGAC
GAATGAGAGGGACGAACAATCGGTCAAGTCCGATCAAGTGCTGCCGTCCCCCCGAGACGAAGAGGGTCTGGAGTT
TAAGAAGAGCGAGAAGGCGGCAAAGGCAGCTCAAGTCAACTTGTCTGCCAAGCTGTCCAAGGAGGGCAAGACACA
GAGCAATGCCGGTTTCGGGGAGATTTGGAGGCTTGTTAAAGTCGCCAGTCCCGAGATCAGATGGCTGGCCGTTGC
CTTTTTCTTTCTCGTCATTGGTTCCAGCGTTACCATGTTGATTCCCTTCTCCGTCGGCCGGATCCTGGACCTTGC
CTCGAAAGGTGACAGCGACGATGTCCGTGTCTTCGGCCTGACGCTGAACCAGTTCTTCATGGGCCTCGGTGCGAT
CCTGACTCTGGGTGCCATGGCCAACTTTGGACGGATCGTCTTGCTGCGCATTGTGGGTGAGAGAGTCGTGGCTCG
GTTGCGATCTCAGCTGTACAGACGCACCTACGTTCAAGACGCAGAGTTTTTCGATGCCAACAGGGTGGGAGACCT
GATTTCGCGCCTCAGCTCCGATACGGTCATCGTTGGGAAATCGGTCACGCAGAACTTGAGCGACGGCCTTCGATC
CCTGTTTAGTGGCGGTGCCGGATTCGCCATCATGGTCTGGACCAGCGCCAAACTCACTGGGCTGCTGCTGCTCAT
GTTCCCTCCCATTGCCGTTGGGGCTTTCTTCTACGGTCGGGCCATCAGAAACATTAGCAGAGCCCTGCAGAAGAA
CCTTGGATCGCTGACGAAAATCGCCGAAGAACGGTTGGGCAACATCAAGACGAGTCAAGCGTTCGTTGGAGAGGT
CCAAGAGGTCGGGCGCTACAACAAACAGATTCGACGCATCTTTGCGCTTGGAAAAAAGGAATCGCTCACCGCGGC
AACTTTCTTTGCCTCCACTGGATGGGCCGGGAACATGACGATTCTGGCCATGCTCATCGTTGGCGGCAGCTTCGT
GCGATCCGGCGAGATGTCTATTGGCGACCTCACGTCGTTTATGATGTATACGGCCTTTGCCGGCTCCAGCTTATT
CGGCCTGTCGGGCTTCTACTCGGAGCTGATGAAGGGCGTAGGCGCTGCCAGCCGACTGTTTGAGCTGCAAGACCG
CAAGCCGGGAATTCACCAGACGGTCGGCCTCCGGGTCACATCAGCTCAGGGTCCTATTCGATTCAGTGACGTTGT
TTTTGCCTATCCGACTCGGCCGGCGGTAAAGATCTTCAACGGGCTGAACTTTGAGATACCGTCGGGCAGCAACGT
CTGCGTTGTTGGGCCTTCCGGAGGCGGCAAGTCTACGGTGGCCGCCTTACTGCTGAGATTCTACAAGGCAACTTC
GGGCAGTATTACCATCAACGGCGTCGACATCTCGAAAATGAATGTCAAATCACTGAGGCGACGGATTGGAGTGGT
GTCTCAGGAGCCTGTGCTCTTCTCTGGATCCATCGCCGAGAACATTGCGTACGGAAACCCCATGGCGCTGCGGGC
GGAAATCGTGTCGGCCGCCAGGCGGGCCAATTGCAATTTCATCAGCGACCTTCCGGACGGCCTCGAGACCCAGGT
CGGAGCCAGGGGGTCTCAGTTGTCAGGCGGGCAGAAGCAGCGGATCGCCATTGCCCGGGCACTTCTCAAGGATCC
GGATATTCTGATCCTCGACGAGGCCACGTCGGCGCTGGATGCTGAATCGGAAACGCTGGTGAACGAAGCCTTGGC
AGGGCTGCTGCGCGGTCGCAATACGACGATATCCATCGCTCATCGGCTGTCGACAATCAAGCGATCGGATCAAAT
CATTGTCCTCAACACCGAGGGCAAAGTAGCTGAGATTGGCAGTTACGCTAAGCTTGCGGTCGACAAACAAAGCGC
CTTTACCAAGCTGATGGAGTGGCAGATGAGCGGAGGAGACATTCCCGAAAAGAGAAGCTCTGATTCTGGTCCTCA
CTTCACTGAGGCGGAAGAGATGGAGCAAGAATTTGACCTCGAGGACGACGAAGGGCCTGACGAGGACCAAAAGGG
GGGAAAGCAACCTTGGCGGCCTGACGATGATGAGGGCCGGCGGCGTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail