Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06090
Gene name
Locationscaffold_07:1213425..1213862
Strand-
Gene length (bp)437
Transcript length (bp)213
Coding sequence length (bp)213
Protein length (aa) 71

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02238 COX7a Cytochrome c oxidase subunit VII 1.0E-19 8 62

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 1981.63 1131.16 2832.10
Alive In ants, during behavior modification 1298.80 691.50 1906.10
Dead In ants, recently dead 1124.84 599.62 1650.06

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.030531 yes
Alive Dead 0.463876 no
Dead Fungus 0.002117 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06090
MGLIDKKNHVIDHQRYYQNAFQAHTRLWRINPRSRIYLVPFQVLVWGSLGATLYAAGRKVCGYNTWFSKN*
Coding >Ophcf2|06090
ATGGGTCTAATCGACAAGAAGAACCATGTGATTGATCACCAGCGCTACTACCAGAATGCCTTTCAGGCGCATACT
CGCCTCTGGAGGATTAATCCACGATCTCGCATATACCTGGTGCCCTTCCAAGTCTTGGTCTGGGGCAGCTTGGGA
GCTACATTGTACGCCGCTGGTCGCAAGGTCTGTGGCTACAACACATGGTTCAGCAAGAATTAA
Transcript >Ophcf2|06090
ATGGGTCTAATCGACAAGAAGAACCATGTGATTGATCACCAGCGCTACTACCAGAATGCCTTTCAGGCGCATACT
CGCCTCTGGAGGATTAATCCACGATCTCGCATATACCTGGTGCCCTTCCAAGTCTTGGTCTGGGGCAGCTTGGGA
GCTACATTGTACGCCGCTGGTCGCAAGGTCTGTGGCTACAACACATGGTTCAGCAAGAATTAA
Gene >Ophcf2|06090
ATGGGGTATGTCTCTGAATCTCGCGCAGCTTCCAGAGTCTATTCGTGACAATCCCTGCCCGCCGCTCAGGGTTCC
CGATCGCGCGTTGCCGCCAGTCCGCCAACAGCACGCTGACGGAGGAACAGTCTAATCGACAAGAAGAACCATGTG
ATTGATCACCAGCGCTACTACCAGAATGCCTTTCAGGCGCATACTCGCCTCTGGAGGATTGTACGGCCGCAGAGC
GGGAGCTGATGAGGCCATAAAATTGACAAGGTTTCTAGAATCCACGATCTCGCATATACCTGGTGCCCTTCCAAG
TCTTGGTCTGGGGCAGCTTGGGAGGTTTGTCTCAAGGCTCGCTTGCGCTTTCTTCTCATTCTAACGGGCTCACAG
CTACATTGTACGCCGCTGGTCGCAAGGTCTGTGGCTACAACACATGGTTCAGCAAGAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail