Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06084
Gene name
Locationscaffold_07:1200970..1202976
Strand-
Gene length (bp)2006
Transcript length (bp)1944
Coding sequence length (bp)1944
Protein length (aa) 648

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF17004 SRP_TPR_like Putative TPR-like repeat 2.1E-21 19 149
PF08492 SRP72 SRP72 RNA-binding domain 2.5E-16 544 594

GO

GO Term Description Terminal node
GO:0006614 SRP-dependent cotranslational protein targeting to membrane Yes
GO:0048500 signal recognition particle Yes
GO:0008312 7S RNA binding Yes
GO:0051649 establishment of localization in cell No
GO:0033365 protein localization to organelle No
GO:0006605 protein targeting No
GO:0003723 RNA binding No
GO:0006886 intracellular protein transport No
GO:0090150 establishment of protein localization to membrane No
GO:0008104 protein localization No
GO:0045047 protein targeting to ER No
GO:1901363 heterocyclic compound binding No
GO:0071702 organic substance transport No
GO:0006613 cotranslational protein targeting to membrane No
GO:0033036 macromolecule localization No
GO:0003676 nucleic acid binding No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0070727 cellular macromolecule localization No
GO:0051234 establishment of localization No
GO:0097159 organic cyclic compound binding No
GO:0006612 protein targeting to membrane No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0008150 biological_process No
GO:0045184 establishment of protein localization No
GO:0070972 protein localization to endoplasmic reticulum No
GO:0071705 nitrogen compound transport No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:1990904 ribonucleoprotein complex No
GO:0005575 cellular_component No
GO:0015031 protein transport No
GO:0032991 protein-containing complex No
GO:0051668 localization within membrane No
GO:0072594 establishment of protein localization to organelle No
GO:0072657 protein localization to membrane No
GO:0072599 establishment of protein localization to endoplasmic reticulum No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3822 0.7527 0.0085 0.0123 0.0954 0.0099 0.2224 0.0063 0.0603 0.0021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup4836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|297
Ophiocordyceps australis map64 (Brazil) OphauB2|5714
Ophiocordyceps camponoti-floridani Ophcf2|06084 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|3869
Ophiocordyceps kimflemingae Ophio5|210
Ophiocordyceps subramaniannii Hirsu2|1079

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06084
MAPDAAAALSALLRSASIDDHDEILKAANAAIKANKSNQIAQRTRVVSLLKLDRFQDAIAAIREGGEKLEAVCHL
EMAYSLYKTGQLDEASAIIDSAGLDTRSIKHVAAQVSYRAERFSEAESIYRHLMHADVAHEGNDLSINIRAAQAQ
SEWQGSASTPFDDGQASLDTFELCYNTACAHIARGSLGTASELLTRAVDLCRASDDLTQEDQDAELQPILAQQAY
VYGRLGDVEKALNVYQSLQSLKNDDPDSFVVAESNRTTLLSGKTNPYLVQRRATAWMSGAASAKLFRYQSNAILR
NSLLVDLEAHKIDGVEHRTRRMLNLARHSSTSPETAAASVINVAAQTKGLRKNELRRKVADMLKKSPDSVALVIL
MIQLLVREDRIESAMSLLETFFGRLEASDNDEDKDVRFSPGLVALAVSLMKAKGREASIKAELTKAAAYWRERPL
ALSASLMREAGLELAKSSDPADLSLAAAALGRLYDEDKGSPLVAAGLTAALATTDASQIEQLTATLPPVESLIND
IDIDALASAGIVTPASQATTTSKRPAPDTAEGTAKKRRRRTRLPKNMEEGKTPDPERWLPLRDRSTYRPKGKKGK
KKAAESTQGGPVKQEETLELVGGGGVKVEKTGVAVSSAKKKKKKGKK*
Coding >Ophcf2|06084
ATGGCTCCGGACGCTGCCGCCGCTCTCAGCGCCCTGCTGCGGTCCGCCTCCATCGACGACCATGACGAGATCCTC
AAGGCGGCCAACGCGGCCATCAAGGCCAACAAGAGCAACCAAATCGCACAGCGCACCCGCGTCGTCTCGCTGCTG
AAGCTCGACCGCTTCCAGGACGCCATCGCTGCCATTCGCGAAGGAGGCGAAAAGCTCGAGGCCGTTTGCCATCTC
GAAATGGCTTACTCCCTCTACAAAACGGGGCAGCTCGACGAAGCTTCTGCTATTATCGACTCGGCAGGCCTCGAC
ACAAGAAGCATCAAGCATGTTGCTGCCCAGGTGTCCTACCGGGCTGAAAGGTTCAGCGAGGCAGAGTCCATCTAC
CGCCACCTGATGCATGCCGATGTGGCCCACGAGGGCAATGACCTGAGCATCAACATCAGGGCCGCCCAGGCCCAG
TCTGAGTGGCAAGGGTCCGCATCCACCCCGTTCGATGACGGTCAAGCCAGTCTCGACACTTTCGAACTCTGCTAC
AACACTGCATGTGCTCACATCGCCCGCGGATCCCTCGGCACAGCATCTGAGCTTCTTACGCGAGCCGTCGACCTG
TGCAGAGCCTCGGATGACCTGACACAAGAAGACCAAGATGCTGAGCTGCAGCCTATACTTGCGCAACAAGCCTAC
GTCTACGGTCGCTTAGGCGATGTTGAAAAAGCTTTGAATGTCTATCAATCACTCCAATCGCTGAAAAATGACGAT
CCGGATTCGTTCGTCGTGGCCGAGAGCAACCGAACCACCCTGCTAAGTGGCAAAACGAACCCATACCTGGTCCAA
CGCCGAGCAACGGCCTGGATGTCTGGCGCTGCATCAGCCAAACTCTTCCGCTACCAATCCAATGCAATCCTGCGC
AATTCTCTCTTAGTAGACCTTGAAGCGCACAAGATCGATGGAGTCGAGCACAGAACACGCAGGATGCTGAACTTG
GCGCGGCACTCATCCACGAGCCCTGAGACGGCTGCTGCATCCGTGATCAATGTCGCTGCTCAGACAAAAGGGCTG
AGGAAGAACGAGCTGCGCCGAAAGGTAGCCGACATGCTGAAGAAGAGTCCAGACAGTGTTGCACTCGTCATCCTC
ATGATACAGCTTCTCGTACGAGAAGACAGGATCGAGTCGGCCATGTCCTTGCTTGAGACGTTCTTCGGCCGACTC
GAAGCATCTGACAACGACGAGGACAAAGACGTCCGCTTCAGCCCGGGTCTAGTCGCTCTGGCGGTGTCACTGATG
AAGGCAAAGGGAAGAGAGGCCTCGATCAAAGCCGAACTGACCAAGGCCGCGGCCTACTGGCGCGAGAGACCGCTG
GCTTTGTCTGCCTCACTCATGAGAGAAGCTGGTTTGGAATTAGCCAAATCATCAGACCCTGCCGATCTCTCCCTC
GCCGCTGCTGCCCTCGGACGACTCTACGATGAGGACAAAGGCTCGCCCCTAGTCGCGGCCGGGCTTACAGCAGCG
CTGGCCACGACGGACGCGTCACAGATCGAGCAGCTCACTGCCACCCTGCCACCCGTCGAAAGCCTTATCAACGAC
ATAGACATCGACGCCCTAGCCAGCGCAGGAATCGTCACACCCGCCTCGCAAGCCACCACGACCTCAAAGCGCCCC
GCCCCCGACACCGCCGAAGGCACCGCCAAAAAGCGCAGACGGCGCACCAGGCTGCCCAAGAACATGGAGGAGGGC
AAGACGCCCGATCCCGAGCGCTGGCTGCCCCTCCGCGACCGCTCGACTTACCGTCCAAAGGGCAAGAAGGGCAAG
AAGAAGGCGGCTGAGTCGACGCAGGGCGGCCCGGTCAAGCAGGAGGAGACGCTCGAGCTCGTCGGCGGAGGGGGC
GTAAAGGTTGAGAAGACGGGCGTGGCTGTGAGCTCGGCGAAGAAGAAGAAGAAGAAGGGCAAGAAATAG
Transcript >Ophcf2|06084
ATGGCTCCGGACGCTGCCGCCGCTCTCAGCGCCCTGCTGCGGTCCGCCTCCATCGACGACCATGACGAGATCCTC
AAGGCGGCCAACGCGGCCATCAAGGCCAACAAGAGCAACCAAATCGCACAGCGCACCCGCGTCGTCTCGCTGCTG
AAGCTCGACCGCTTCCAGGACGCCATCGCTGCCATTCGCGAAGGAGGCGAAAAGCTCGAGGCCGTTTGCCATCTC
GAAATGGCTTACTCCCTCTACAAAACGGGGCAGCTCGACGAAGCTTCTGCTATTATCGACTCGGCAGGCCTCGAC
ACAAGAAGCATCAAGCATGTTGCTGCCCAGGTGTCCTACCGGGCTGAAAGGTTCAGCGAGGCAGAGTCCATCTAC
CGCCACCTGATGCATGCCGATGTGGCCCACGAGGGCAATGACCTGAGCATCAACATCAGGGCCGCCCAGGCCCAG
TCTGAGTGGCAAGGGTCCGCATCCACCCCGTTCGATGACGGTCAAGCCAGTCTCGACACTTTCGAACTCTGCTAC
AACACTGCATGTGCTCACATCGCCCGCGGATCCCTCGGCACAGCATCTGAGCTTCTTACGCGAGCCGTCGACCTG
TGCAGAGCCTCGGATGACCTGACACAAGAAGACCAAGATGCTGAGCTGCAGCCTATACTTGCGCAACAAGCCTAC
GTCTACGGTCGCTTAGGCGATGTTGAAAAAGCTTTGAATGTCTATCAATCACTCCAATCGCTGAAAAATGACGAT
CCGGATTCGTTCGTCGTGGCCGAGAGCAACCGAACCACCCTGCTAAGTGGCAAAACGAACCCATACCTGGTCCAA
CGCCGAGCAACGGCCTGGATGTCTGGCGCTGCATCAGCCAAACTCTTCCGCTACCAATCCAATGCAATCCTGCGC
AATTCTCTCTTAGTAGACCTTGAAGCGCACAAGATCGATGGAGTCGAGCACAGAACACGCAGGATGCTGAACTTG
GCGCGGCACTCATCCACGAGCCCTGAGACGGCTGCTGCATCCGTGATCAATGTCGCTGCTCAGACAAAAGGGCTG
AGGAAGAACGAGCTGCGCCGAAAGGTAGCCGACATGCTGAAGAAGAGTCCAGACAGTGTTGCACTCGTCATCCTC
ATGATACAGCTTCTCGTACGAGAAGACAGGATCGAGTCGGCCATGTCCTTGCTTGAGACGTTCTTCGGCCGACTC
GAAGCATCTGACAACGACGAGGACAAAGACGTCCGCTTCAGCCCGGGTCTAGTCGCTCTGGCGGTGTCACTGATG
AAGGCAAAGGGAAGAGAGGCCTCGATCAAAGCCGAACTGACCAAGGCCGCGGCCTACTGGCGCGAGAGACCGCTG
GCTTTGTCTGCCTCACTCATGAGAGAAGCTGGTTTGGAATTAGCCAAATCATCAGACCCTGCCGATCTCTCCCTC
GCCGCTGCTGCCCTCGGACGACTCTACGATGAGGACAAAGGCTCGCCCCTAGTCGCGGCCGGGCTTACAGCAGCG
CTGGCCACGACGGACGCGTCACAGATCGAGCAGCTCACTGCCACCCTGCCACCCGTCGAAAGCCTTATCAACGAC
ATAGACATCGACGCCCTAGCCAGCGCAGGAATCGTCACACCCGCCTCGCAAGCCACCACGACCTCAAAGCGCCCC
GCCCCCGACACCGCCGAAGGCACCGCCAAAAAGCGCAGACGGCGCACCAGGCTGCCCAAGAACATGGAGGAGGGC
AAGACGCCCGATCCCGAGCGCTGGCTGCCCCTCCGCGACCGCTCGACTTACCGTCCAAAGGGCAAGAAGGGCAAG
AAGAAGGCGGCTGAGTCGACGCAGGGCGGCCCGGTCAAGCAGGAGGAGACGCTCGAGCTCGTCGGCGGAGGGGGC
GTAAAGGTTGAGAAGACGGGCGTGGCTGTGAGCTCGGCGAAGAAGAAGAAGAAGAAGGGCAAGAAATAG
Gene >Ophcf2|06084
ATGGCTCCGGACGCTGCCGCCGCTCTCAGCGCCCTGCTGCGGTCCGCCTCCATCGACGACCATGACGAGATCCTC
AAGGCGGCCAACGCGGCCATCAAGGCCAACAAGAGCAACCAAATCGCACAGCGCACCCGCGTCGTCTCGCTGCTG
AAGCTCGACCGCTTCCAGGACGCCATCGCTGCCATTCGCGAAGGAGGCGAAAAGCTCGAGGCCGTTTGCCATCTC
GAAATGGCTTACTCCCTCTACAAAACGGGGCAGCTCGACGAAGCTTCTGCTATTATCGACTCGGCAGGCCTCGAC
ACAAGAAGCATCAAGCATGTTGCTGCCCAGGTGTCCTACCGGGCTGAAAGGTTCAGCGAGGCAGAGTCCATCTAC
CGCCACCTGATGCATGCCGATGTGGCCCACGAGGGCAATGACCTGAGCATCAACATCAGGGCCGCCCAGGCCCAG
TCTGAGTGGCAAGGGTCCGCATCCACCCCGTTCGATGACGGTCAAGCCAGTCTCGACACTTTCGAACTCTGCTAC
AACACTGCATGTGCTCACATCGCCCGCGGATCCCTCGGCACAGCATCTGAGCTTCTTACGCGAGCCGTCGACCTG
TGCAGAGCCTCGGATGACCTGACACAAGAAGACCAAGATGCTGAGCTGCAGCCTATACTTGCGCAACAAGCCTAC
GTCTACGGTCGCTTAGGCGATGTTGAAAAAGCTTTGAATGTCTATCAATCACTCCAATCGCTGAAGTGAGTCGTT
TTCACCACTGTTCCCTTCGCCCCGGACCAGGCTAACCATCCTGTCAACCAAGAAATGACGATCCGGATTCGTTCG
TCGTGGCCGAGAGCAACCGAACCACCCTGCTAAGTGGCAAAACGAACCCATACCTGGTCCAACGCCGAGCAACGG
CCTGGATGTCTGGCGCTGCATCAGCCAAACTCTTCCGCTACCAATCCAATGCAATCCTGCGCAATTCTCTCTTAG
TAGACCTTGAAGCGCACAAGATCGATGGAGTCGAGCACAGAACACGCAGGATGCTGAACTTGGCGCGGCACTCAT
CCACGAGCCCTGAGACGGCTGCTGCATCCGTGATCAATGTCGCTGCTCAGACAAAAGGGCTGAGGAAGAACGAGC
TGCGCCGAAAGGTAGCCGACATGCTGAAGAAGAGTCCAGACAGTGTTGCACTCGTCATCCTCATGATACAGCTTC
TCGTACGAGAAGACAGGATCGAGTCGGCCATGTCCTTGCTTGAGACGTTCTTCGGCCGACTCGAAGCATCTGACA
ACGACGAGGACAAAGACGTCCGCTTCAGCCCGGGTCTAGTCGCTCTGGCGGTGTCACTGATGAAGGCAAAGGGAA
GAGAGGCCTCGATCAAAGCCGAACTGACCAAGGCCGCGGCCTACTGGCGCGAGAGACCGCTGGCTTTGTCTGCCT
CACTCATGAGAGAAGCTGGTTTGGAATTAGCCAAATCATCAGACCCTGCCGATCTCTCCCTCGCCGCTGCTGCCC
TCGGACGACTCTACGATGAGGACAAAGGCTCGCCCCTAGTCGCGGCCGGGCTTACAGCAGCGCTGGCCACGACGG
ACGCGTCACAGATCGAGCAGCTCACTGCCACCCTGCCACCCGTCGAAAGCCTTATCAACGACATAGACATCGACG
CCCTAGCCAGCGCAGGAATCGTCACACCCGCCTCGCAAGCCACCACGACCTCAAAGCGCCCCGCCCCCGACACCG
CCGAAGGCACCGCCAAAAAGCGCAGACGGCGCACCAGGCTGCCCAAGAACATGGAGGAGGGCAAGACGCCCGATC
CCGAGCGCTGGCTGCCCCTCCGCGACCGCTCGACTTACCGTCCAAAGGGCAAGAAGGGCAAGAAGAAGGCGGCTG
AGTCGACGCAGGGCGGCCCGGTCAAGCAGGAGGAGACGCTCGAGCTCGTCGGCGGAGGGGGCGTAAAGGTTGAGA
AGACGGGCGTGGCTGTGAGCTCGGCGAAGAAGAAGAAGAAGAAGGGCAAGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail