Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06081
Gene name
Locationscaffold_07:1190849..1191959
Strand+
Gene length (bp)1110
Transcript length (bp)1110
Coding sequence length (bp)1110
Protein length (aa) 370

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.5E-08 8 54
PF00249 Myb_DNA-binding Myb-like DNA-binding domain 2.2E-07 64 102
PF13921 Myb_DNA-bind_6 Myb-like DNA-binding domain 5.6E-09 11 67

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.4901 0.8808 0.0028 0.0303 0.1315 0.0007 0.0238 0.0486 0.0066 0.0987

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5118
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6901
Ophiocordyceps australis map64 (Brazil) OphauB2|4589
Ophiocordyceps camponoti-floridani Ophcf2|06081 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|879
Ophiocordyceps kimflemingae Ophio5|4100
Ophiocordyceps subramaniannii Hirsu2|3373

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06081
MTSPGHKRGPWSTFEDSRLMLLVNSEPSLNWVRISSSLGSRSAKQCRERYHQNLKPNLNHDPITNEEGMLIETLV
TDLGRRWAEIARHLPGRSDNAVKNWWNGNQNRRKRQDRRRGANPSGELLSAPGQSVYRHPTPEMQPQQAMPTFQH
QRNYPIQKSYSAFPAFSTRTHEMQPQSQVFDDDRHPRIPLFPVASPGRQSWQSHSHSPPSVTEQYNYNRLYYHGE
MPLPSPCLSEHPESDAGSNYTFSPTVASRTLSRGHNSIELPPMRTQMIQSPLPRLPSTPLPLTYTCKSLPSLRDV
APRYSQGEPYNESFPRLPPVGSGGRQPPPAVPGQLLTAPSSPLQSQEQQQSWVNWKRKDSRMKLSSLLH*
Coding >Ophcf2|06081
ATGACATCGCCCGGCCATAAGCGAGGCCCGTGGTCCACTTTCGAGGATAGCCGGCTGATGCTGCTGGTCAATTCG
GAACCAAGCCTGAACTGGGTCCGCATTTCCTCTTCACTGGGCTCACGCAGCGCAAAGCAGTGTCGCGAGCGATAT
CATCAGAATCTCAAGCCGAACCTGAATCATGATCCCATCACCAACGAAGAGGGCATGTTAATCGAGACCTTGGTG
ACAGACCTCGGCAGAAGATGGGCCGAGATCGCCCGTCATTTGCCTGGCCGAAGCGACAATGCCGTCAAGAACTGG
TGGAACGGCAATCAAAACCGCCGTAAACGCCAGGATCGCAGGCGTGGAGCAAACCCCTCGGGAGAACTACTATCG
GCACCGGGTCAGTCGGTCTACAGGCATCCAACCCCCGAGATGCAGCCTCAGCAAGCAATGCCAACCTTCCAGCAT
CAGCGAAACTATCCTATACAGAAGTCTTATTCCGCGTTTCCAGCATTCTCTACTCGAACGCACGAGATGCAGCCT
CAGTCACAGGTTTTCGACGATGATCGCCATCCCCGTATCCCCCTTTTCCCAGTGGCAAGTCCCGGCCGTCAGTCT
TGGCAGTCGCACTCGCATTCGCCTCCGAGTGTGACAGAGCAGTACAACTACAATCGTCTGTATTATCACGGGGAA
ATGCCGCTGCCCTCGCCTTGTCTGTCCGAGCACCCCGAGTCGGACGCCGGATCAAACTATACATTCTCGCCTACT
GTTGCCTCACGGACTCTGAGCCGGGGCCACAATTCCATTGAGCTACCGCCAATGCGCACCCAGATGATACAGAGC
CCACTCCCCCGGTTGCCTTCGACTCCGCTGCCCCTGACTTACACCTGCAAAAGTCTCCCCAGTCTCCGGGATGTG
GCTCCGAGGTATTCCCAGGGCGAGCCGTACAACGAATCGTTTCCACGCCTGCCTCCCGTTGGATCTGGGGGTCGA
CAGCCGCCTCCAGCTGTCCCGGGACAACTGCTCACGGCGCCTAGCTCGCCGTTGCAAAGCCAGGAACAGCAGCAG
TCATGGGTCAATTGGAAGAGGAAGGACTCGAGAATGAAGCTGTCATCATTGCTGCATTGA
Transcript >Ophcf2|06081
ATGACATCGCCCGGCCATAAGCGAGGCCCGTGGTCCACTTTCGAGGATAGCCGGCTGATGCTGCTGGTCAATTCG
GAACCAAGCCTGAACTGGGTCCGCATTTCCTCTTCACTGGGCTCACGCAGCGCAAAGCAGTGTCGCGAGCGATAT
CATCAGAATCTCAAGCCGAACCTGAATCATGATCCCATCACCAACGAAGAGGGCATGTTAATCGAGACCTTGGTG
ACAGACCTCGGCAGAAGATGGGCCGAGATCGCCCGTCATTTGCCTGGCCGAAGCGACAATGCCGTCAAGAACTGG
TGGAACGGCAATCAAAACCGCCGTAAACGCCAGGATCGCAGGCGTGGAGCAAACCCCTCGGGAGAACTACTATCG
GCACCGGGTCAGTCGGTCTACAGGCATCCAACCCCCGAGATGCAGCCTCAGCAAGCAATGCCAACCTTCCAGCAT
CAGCGAAACTATCCTATACAGAAGTCTTATTCCGCGTTTCCAGCATTCTCTACTCGAACGCACGAGATGCAGCCT
CAGTCACAGGTTTTCGACGATGATCGCCATCCCCGTATCCCCCTTTTCCCAGTGGCAAGTCCCGGCCGTCAGTCT
TGGCAGTCGCACTCGCATTCGCCTCCGAGTGTGACAGAGCAGTACAACTACAATCGTCTGTATTATCACGGGGAA
ATGCCGCTGCCCTCGCCTTGTCTGTCCGAGCACCCCGAGTCGGACGCCGGATCAAACTATACATTCTCGCCTACT
GTTGCCTCACGGACTCTGAGCCGGGGCCACAATTCCATTGAGCTACCGCCAATGCGCACCCAGATGATACAGAGC
CCACTCCCCCGGTTGCCTTCGACTCCGCTGCCCCTGACTTACACCTGCAAAAGTCTCCCCAGTCTCCGGGATGTG
GCTCCGAGGTATTCCCAGGGCGAGCCGTACAACGAATCGTTTCCACGCCTGCCTCCCGTTGGATCTGGGGGTCGA
CAGCCGCCTCCAGCTGTCCCGGGACAACTGCTCACGGCGCCTAGCTCGCCGTTGCAAAGCCAGGAACAGCAGCAG
TCATGGGTCAATTGGAAGAGGAAGGACTCGAGAATGAAGCTGTCATCATTGCTGCATTGA
Gene >Ophcf2|06081
ATGACATCGCCCGGCCATAAGCGAGGCCCGTGGTCCACTTTCGAGGATAGCCGGCTGATGCTGCTGGTCAATTCG
GAACCAAGCCTGAACTGGGTCCGCATTTCCTCTTCACTGGGCTCACGCAGCGCAAAGCAGTGTCGCGAGCGATAT
CATCAGAATCTCAAGCCGAACCTGAATCATGATCCCATCACCAACGAAGAGGGCATGTTAATCGAGACCTTGGTG
ACAGACCTCGGCAGAAGATGGGCCGAGATCGCCCGTCATTTGCCTGGCCGAAGCGACAATGCCGTCAAGAACTGG
TGGAACGGCAATCAAAACCGCCGTAAACGCCAGGATCGCAGGCGTGGAGCAAACCCCTCGGGAGAACTACTATCG
GCACCGGGTCAGTCGGTCTACAGGCATCCAACCCCCGAGATGCAGCCTCAGCAAGCAATGCCAACCTTCCAGCAT
CAGCGAAACTATCCTATACAGAAGTCTTATTCCGCGTTTCCAGCATTCTCTACTCGAACGCACGAGATGCAGCCT
CAGTCACAGGTTTTCGACGATGATCGCCATCCCCGTATCCCCCTTTTCCCAGTGGCAAGTCCCGGCCGTCAGTCT
TGGCAGTCGCACTCGCATTCGCCTCCGAGTGTGACAGAGCAGTACAACTACAATCGTCTGTATTATCACGGGGAA
ATGCCGCTGCCCTCGCCTTGTCTGTCCGAGCACCCCGAGTCGGACGCCGGATCAAACTATACATTCTCGCCTACT
GTTGCCTCACGGACTCTGAGCCGGGGCCACAATTCCATTGAGCTACCGCCAATGCGCACCCAGATGATACAGAGC
CCACTCCCCCGGTTGCCTTCGACTCCGCTGCCCCTGACTTACACCTGCAAAAGTCTCCCCAGTCTCCGGGATGTG
GCTCCGAGGTATTCCCAGGGCGAGCCGTACAACGAATCGTTTCCACGCCTGCCTCCCGTTGGATCTGGGGGTCGA
CAGCCGCCTCCAGCTGTCCCGGGACAACTGCTCACGGCGCCTAGCTCGCCGTTGCAAAGCCAGGAACAGCAGCAG
TCATGGGTCAATTGGAAGAGGAAGGACTCGAGAATGAAGCTGTCATCATTGCTGCATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail