Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06077
Gene name
Locationscaffold_07:1179120..1179747
Strand+
Gene length (bp)627
Transcript length (bp)453
Coding sequence length (bp)453
Protein length (aa) 151

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01124 MAPEG MAPEG family 8.9E-22 15 141

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 30 0.5

Transmembrane Domains

Domain # Start End Length
1 10 27 17
2 79 101 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 15.13 3.29 26.97
Alive In ants, during behavior modification 13.39 2.76 24.01
Dead In ants, recently dead 10.16 1.40 18.92

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.772165 no
Alive Dead 0.425052 no
Dead Fungus 0.315295 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06077
MAIPLELPDQYGLVLAAATSTFFVNTMHAFRTMKFRKASGVEYPQSYATNEQAAKNPSAYRFNCAQRAHHNFTEN
HTSLLGALLIAGIRYPVPAAALGAGWSLSRIMYLLGYTSSAGPRGRLLGAIGGNLSDLFLKLAAAYSSAMFVLGK
*
Coding >Ophcf2|06077
ATGGCGATTCCTCTTGAACTCCCTGATCAGTATGGCCTGGTGCTCGCGGCCGCCACGAGTACTTTCTTCGTCAAT
ACAATGCACGCCTTCCGCACCATGAAGTTCCGCAAAGCCAGCGGAGTCGAATATCCTCAAAGCTACGCCACCAAC
GAACAGGCGGCCAAGAATCCGTCCGCCTACCGATTCAACTGCGCTCAACGAGCTCACCACAACTTTACCGAGAAC
CACACATCTCTTCTCGGCGCTTTGCTCATCGCTGGTATTCGCTATCCTGTTCCTGCGGCCGCCCTCGGAGCTGGA
TGGAGCTTGTCGAGAATTATGTACCTGCTCGGCTATACCAGCTCTGCCGGCCCTCGCGGCCGACTGCTCGGTGCC
ATTGGCGGCAATCTGAGCGACTTGTTCCTCAAACTAGCCGCGGCCTACTCATCTGCCATGTTCGTTCTTGGCAAA
TAG
Transcript >Ophcf2|06077
ATGGCGATTCCTCTTGAACTCCCTGATCAGTATGGCCTGGTGCTCGCGGCCGCCACGAGTACTTTCTTCGTCAAT
ACAATGCACGCCTTCCGCACCATGAAGTTCCGCAAAGCCAGCGGAGTCGAATATCCTCAAAGCTACGCCACCAAC
GAACAGGCGGCCAAGAATCCGTCCGCCTACCGATTCAACTGCGCTCAACGAGCTCACCACAACTTTACCGAGAAC
CACACATCTCTTCTCGGCGCTTTGCTCATCGCTGGTATTCGCTATCCTGTTCCTGCGGCCGCCCTCGGAGCTGGA
TGGAGCTTGTCGAGAATTATGTACCTGCTCGGCTATACCAGCTCTGCCGGCCCTCGCGGCCGACTGCTCGGTGCC
ATTGGCGGCAATCTGAGCGACTTGTTCCTCAAACTAGCCGCGGCCTACTCATCTGCCATGTTCGTTCTTGGCAAA
TAG
Gene >Ophcf2|06077
ATGGCGATTCCTCTTGAACTCCCTGATCAGTATGGGTCAGTGAGAGAGAGGACCTTGGAATATCGTTCCATGAGA
GATGGCTAACAGCTGCCTATCCTTCAGCCTGGTGCTCGCGGCCGCCACGAGTACTTTCTTCGTCAATACAATGCA
CGCCTTCCGCACCATGAAGTTCCGCAAAGCCAGCGGAGTCGAATATCCTCAAAGCTACGCCACCAACGAACAGGC
GGCCAAGAATCCGTCCGCCTACCGATTCAACTGCGGTCCGTTGCCTGTCTTGTTCCCCAGCCGTTCGTCACTGAT
ACTTGACCAGCTCAACGAGCTCACCACAACTTTACCGAGAACCACACATCTCTTCTCGGCGCTTTGCTCATCGCT
GGTATTCGCTATCCTGTTCCTGCGGCCGCCCTCGGAGCTGGATGGAGCTTGTCGAGAATTATGTACCTGCTCGGC
TATACCAGCTCTGCCGGCCCTCGCGGCCGACTGCTGTATGTCCTTTTTTTTTCATGCTTGTCGTCAGCCGAACCG
AACTAATGCGTCTTCAGCGGTGCCATTGGCGGCAATCTGAGCGACTTGTTCCTCAAACTAGCCGCGGCCTACTCA
TCTGCCATGTTCGTTCTTGGCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail