Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06074
Gene name
Locationscaffold_07:1169630..1171622
Strand+
Gene length (bp)1992
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16189 Creatinase_N_2 Creatinase/Prolidase N-terminal domain 1.5E-50 156 326
PF00557 Peptidase_M24 Metallopeptidase family M24 2.4E-44 329 544
PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain 2.0E-16 11 146

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear localization signal 0.6601 0.4831 0.129 0.0843 0.3688 0.0994 0.2152 0.1083 0.2209 0.0315

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5112
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1892
Ophiocordyceps australis map64 (Brazil) OphauB2|5385
Ophiocordyceps camponoti-floridani Ophcf2|06074 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6588
Ophiocordyceps kimflemingae Ophio5|757
Ophiocordyceps subramaniannii Hirsu2|3263

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06074
MAAPKPDISHRLAHLRSLMEERNVDVYIVPSEDSHSSEYVADCDARREFISGFTGSAGWAIVTRTAAALATDGRY
FNQACHELDDSWKLLKQGLQDVPTWQEWAAEQSSGGKVVAVDPELITGLVAKKLSDQIRKAGGAELLPLSENLID
IIWARDRPPRPRRTVTVLPDEYTGKSVRNKVTELRHELAKKNCPGFFISMLDEVAWLFNLRGSDITYNPVFFSYA
IVTPQTVVLYVDESRLNESAKSYLSDNDVQTKPYETFFPDAQRIASEMLEKSLSSECLAPETFFMSNKGSWALRR
ALGGDGTVDETRSPIGDAKAIKNEVEIRGMRECHIRDGAALIEFFAWLEDQLVAKKATLDEVQAATKLEDLRSKH
QHFVGLSFPTISSSGPNAAVIHYSPEPGSCAVIDSQSVYLCDSGAQFLDGTTDTTRTLHFGTPTPAERKAYTLVL
KGVIALETAVFPKGTTGFALDCLARQYLWQDGLDYRHGTGHGVGSYLNVHEGPIGIGTRVQYAEVPLSPGNVLSN
EPGYYEDGHFGIRIENIMLLCLTAKT*
Coding >Ophcf2|06074
ATGGCGGCGCCTAAGCCCGACATATCGCATAGGTTAGCCCACTTACGGAGCTTGATGGAAGAGCGAAACGTGGAT
GTCTACATCGTCCCTTCTGAGGATAGTCATAGCTCTGAGTACGTTGCGGACTGTGATGCACGGCGAGAGTTCATT
AGCGGCTTCACAGGCTCAGCAGGATGGGCTATCGTCACCCGAACTGCTGCTGCACTTGCCACGGACGGACGTTAT
TTCAATCAAGCCTGCCACGAGCTAGATGACAGCTGGAAACTTCTCAAACAGGGCCTTCAAGACGTCCCCACGTGG
CAAGAGTGGGCGGCTGAACAATCTAGCGGAGGAAAAGTTGTAGCTGTTGACCCTGAACTTATCACTGGGCTTGTC
GCCAAGAAGCTCTCGGACCAGATCCGCAAAGCTGGTGGTGCCGAGCTGCTGCCACTTTCGGAGAACTTGATTGAC
ATTATTTGGGCCCGTGACCGACCGCCGCGTCCTCGCCGAACGGTCACTGTTTTGCCAGATGAGTATACTGGGAAA
TCTGTGCGAAACAAGGTCACCGAGCTACGTCACGAGCTTGCCAAGAAGAACTGTCCCGGGTTCTTCATTTCCATG
CTTGACGAGGTGGCTTGGCTATTCAATCTTCGTGGCAGCGATATTACCTATAACCCCGTCTTCTTTTCATATGCA
ATCGTTACTCCCCAAACGGTGGTCTTATACGTCGATGAGTCCCGACTGAACGAGTCGGCAAAGTCCTATCTGTCG
GACAACGACGTTCAAACCAAGCCATACGAGACGTTTTTCCCAGACGCGCAACGTATTGCCTCGGAGATGCTTGAG
AAGTCCTTGTCCTCTGAATGTCTAGCGCCAGAAACGTTCTTCATGTCTAATAAAGGTTCCTGGGCTTTGCGACGT
GCTCTTGGAGGCGATGGCACCGTTGACGAGACCCGAAGTCCTATTGGCGACGCCAAGGCTATTAAAAACGAGGTG
GAAATAAGAGGGATGCGAGAATGTCATATCAGGGATGGCGCCGCGTTGATCGAGTTCTTTGCCTGGCTTGAGGAT
CAGCTCGTGGCTAAGAAAGCCACCTTGGACGAGGTACAGGCCGCCACGAAGCTTGAAGACTTGCGATCAAAGCAT
CAACATTTTGTTGGCTTATCATTTCCAACGATTTCATCAAGCGGTCCTAATGCCGCCGTGATTCACTACAGTCCT
GAGCCGGGGAGCTGCGCAGTCATCGATTCGCAGAGCGTTTACCTGTGCGATTCAGGGGCACAATTCCTGGATGGC
ACCACTGACACGACACGGACGCTTCATTTCGGCACACCTACACCGGCAGAGCGAAAAGCCTATACCTTGGTGCTC
AAAGGTGTAATAGCGCTCGAGACGGCTGTTTTCCCGAAAGGCACCACTGGCTTTGCATTGGATTGTCTTGCTCGG
CAATATTTATGGCAAGACGGTCTGGACTACCGCCATGGCACAGGTCATGGCGTTGGCTCGTATCTCAACGTTCAC
GAGGGACCTATCGGCATCGGTACGCGCGTTCAGTACGCTGAGGTCCCTTTGTCTCCAGGCAACGTTCTTTCGAAC
GAGCCAGGATACTACGAGGATGGACATTTCGGTATCCGCATTGAAAACATTATGCTGTTGTGCCTTACTGCCAAA
ACCTGA
Transcript >Ophcf2|06074
ATGGCGGCGCCTAAGCCCGACATATCGCATAGGTTAGCCCACTTACGGAGCTTGATGGAAGAGCGAAACGTGGAT
GTCTACATCGTCCCTTCTGAGGATAGTCATAGCTCTGAGTACGTTGCGGACTGTGATGCACGGCGAGAGTTCATT
AGCGGCTTCACAGGCTCAGCAGGATGGGCTATCGTCACCCGAACTGCTGCTGCACTTGCCACGGACGGACGTTAT
TTCAATCAAGCCTGCCACGAGCTAGATGACAGCTGGAAACTTCTCAAACAGGGCCTTCAAGACGTCCCCACGTGG
CAAGAGTGGGCGGCTGAACAATCTAGCGGAGGAAAAGTTGTAGCTGTTGACCCTGAACTTATCACTGGGCTTGTC
GCCAAGAAGCTCTCGGACCAGATCCGCAAAGCTGGTGGTGCCGAGCTGCTGCCACTTTCGGAGAACTTGATTGAC
ATTATTTGGGCCCGTGACCGACCGCCGCGTCCTCGCCGAACGGTCACTGTTTTGCCAGATGAGTATACTGGGAAA
TCTGTGCGAAACAAGGTCACCGAGCTACGTCACGAGCTTGCCAAGAAGAACTGTCCCGGGTTCTTCATTTCCATG
CTTGACGAGGTGGCTTGGCTATTCAATCTTCGTGGCAGCGATATTACCTATAACCCCGTCTTCTTTTCATATGCA
ATCGTTACTCCCCAAACGGTGGTCTTATACGTCGATGAGTCCCGACTGAACGAGTCGGCAAAGTCCTATCTGTCG
GACAACGACGTTCAAACCAAGCCATACGAGACGTTTTTCCCAGACGCGCAACGTATTGCCTCGGAGATGCTTGAG
AAGTCCTTGTCCTCTGAATGTCTAGCGCCAGAAACGTTCTTCATGTCTAATAAAGGTTCCTGGGCTTTGCGACGT
GCTCTTGGAGGCGATGGCACCGTTGACGAGACCCGAAGTCCTATTGGCGACGCCAAGGCTATTAAAAACGAGGTG
GAAATAAGAGGGATGCGAGAATGTCATATCAGGGATGGCGCCGCGTTGATCGAGTTCTTTGCCTGGCTTGAGGAT
CAGCTCGTGGCTAAGAAAGCCACCTTGGACGAGGTACAGGCCGCCACGAAGCTTGAAGACTTGCGATCAAAGCAT
CAACATTTTGTTGGCTTATCATTTCCAACGATTTCATCAAGCGGTCCTAATGCCGCCGTGATTCACTACAGTCCT
GAGCCGGGGAGCTGCGCAGTCATCGATTCGCAGAGCGTTTACCTGTGCGATTCAGGGGCACAATTCCTGGATGGC
ACCACTGACACGACACGGACGCTTCATTTCGGCACACCTACACCGGCAGAGCGAAAAGCCTATACCTTGGTGCTC
AAAGGTGTAATAGCGCTCGAGACGGCTGTTTTCCCGAAAGGCACCACTGGCTTTGCATTGGATTGTCTTGCTCGG
CAATATTTATGGCAAGACGGTCTGGACTACCGCCATGGCACAGGTCATGGCGTTGGCTCGTATCTCAACGTTCAC
GAGGGACCTATCGGCATCGGTACGCGCGTTCAGTACGCTGAGGTCCCTTTGTCTCCAGGCAACGTTCTTTCGAAC
GAGCCAGGATACTACGAGGATGGACATTTCGGTATCCGCATTGAAAACATTATGCTGTTGTGCCTTACTGCCAAA
ACCTGA
Gene >Ophcf2|06074
ATGGCGGCGCCTAAGCCCGACATATCGCATAGGTTAGCCCACTTACGGAGCTTGATGGAAGAGCGAAACGTGGAT
GTCTACAGTGAGTGGACTTCAGTGTCCTCGTCTGAGCTACCGTTTGTTCTGCATCCGGTCTCTGACACAATGTCT
GAGCTCCACAGTCGTCCCTTCTGAGGATAGTCATAGCTCTGAGTACGTTGCGGACTGTGATGCACGGCGAGAGTT
CATTAGCGGCTTCACAGGCTCAGCAGGATGGGCTATCGTCACCCGAACTGCTGCTGCACTTGCCACGGACGGACG
TTATTTCAATCAAGCCTGCCACGAGCTAGATGACAGCTGGAAACTTCTCAAACAGGGCCTTCAAGACGTCCCCAC
GTGGCAAGAGTGGGCGGCTGAACAATCTAGCGGAGGAAAAGTTGTAGCTGTTGACCCTGAACTTATCACTGGGCT
TGTCGCCAAGAAGCTCTCGGACCAGATCCGCAAAGCTGGTGGTGCCGAGCTGCTGCCACTTTCGGAGAACTTGAT
TGACATTATTTGGGCCCGTGACCGACCGCCGCGTCCTCGCCGAACGGTCACTGTTTTGCCAGATGAGTATACTGG
GAAATCTGTGCGAAACAAGGTCACCGAGCTACGTCACGAGCTTGCCAAGAAGAACTGTCCCGGGTTCTTCATTTC
CATGCTTGACGAGGTGGCTTGGCTATTCAATCTTCGTGGCAGCGATATTACCTATAACCCCGTCTTCTTTTCATA
TGCAATCGTTACTCCCCAAACGGTGGTCTTATACGTCGATGAGTCCCGACTGAACGAGTCGGCAAAGTCCTATCT
GTCGGACAACGACGTTCAAACCAAGCCATACGAGACGTTTTTCCCAGACGCGCAACGTATTGCCTCGGAGATGCT
TGAGAAGTCCTTGTCCTCTGAATGTCTAGCGCCAGAAACGTTCTTCATGTCTAATAAAGGTTCCTGGGCTTTGCG
ACGTGCTCTTGGAGGCGATGGCACCGTTGACGAGACCCGAAGTCCTATTGGCGACGCCAAGGCTATTAAAAACGA
GGTGGAAATAAGAGGGATGCGAGAATGTCATATCAGGGATGGCGCCGCGTTGATCGAGTTCTTTGCCTGGCTTGA
GGATCAGCTCGTGGCTAAGAAAGCCACCTTGGACGAGGTACAGGCCGCCACGAAGCTTGAAGACTTGCGATCAAA
GCATCAACATTTTGTTGGCTTATCATTTCCAACGATTTCATCAAGCGGTCCTAAGTGAGTTTGCACTTTGAGGCA
TACATGCCTGCCCCCCTTCCACACATTTACCACCCGGGGTTCATTGTACTACAAACTTTAGCTTGCCGTTCATGT
TGGAACATGCTGACCTGCACCAAGTGCCGCCGTGATTCACTACAGTCCTGAGCCGGGGAGCTGCGCAGTCATCGA
TTCGCAGAGCGTTTACCTGTGCGATTCAGGGGCACAATTCCTGGATGGCACCACTGACACGACACGGACGCTTCA
TTTCGGCACACCTACACCGGCAGAGCGAAAAGCCTATACCTTGGTGCTCAAAGGTGTAATAGCGCTCGAGACGGC
TGTTTTCCCGAAAGGCACCACTGGCTTTGCATTGGATTGTCTTGCTCGGCAATATTTATGGGTCAGTACTCTGCC
AATAGATTTGAGGGACTTGGCCTCCTTCAATAGCTAGTTTTACTAACTCAACGCAGCAAGACGGTCTGGACTACC
GCCATGGCACAGGTCATGGCGTTGGCTCGTATCTCAACGTTCACGAGGGACCTATCGGCATCGGTACGCGCGTTC
AGTACGCTGAGGTCCCTTTGTCTCCAGGCAACGTTCTTTCGAACGAGCCAGGATACTACGAGGATGGACATTTCG
GTATCCGCATTGAAAACATTATGCTGGTGAGAGAGGTAAAGACGGAGCACTGCTTTGGTGAAAAACCTTTCCTGG
GCTTTGAGCATGTCACAGTTGTGCCTTACTGCCAAAACCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail