Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06070
Gene name
Locationscaffold_07:945007..948012
Strand-
Gene length (bp)3005
Transcript length (bp)1524
Coding sequence length (bp)1524
Protein length (aa) 508

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13844 Glyco_transf_41 Glycosyl transferase family 41 1.1E-26 247 338
PF13844 Glyco_transf_41 Glycosyl transferase family 41 3.5E-30 411 502

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear localization signal 0.5219 0.7674 0.018 0.1118 0.4711 0.26 0.0668 0.213 0.0969 0.0702

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GT41 2.6E-66 61 338

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5075
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|562
Ophiocordyceps australis map64 (Brazil) OphauB2|4588
Ophiocordyceps camponoti-floridani Ophcf2|06070 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6592
Ophiocordyceps kimflemingae Ophio5|7555
Ophiocordyceps subramaniannii Hirsu2|2911

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06070
MLLGGCLQYGLGYYGSALQWFSRILELDTSHVEAMTNMAATLFCVNRQMYERAVLCDGTFDIALTNLANAVKDKG
RIVDAIAYYRRALCSNPEFDEAVCGLFIALNFVCDWRGRGGVLLTSGDYDRWHVDDDGKILDARKQSGARGLAMR
VVGIVAHQLRDASSWGQHTLREPVIQAVEQQLRHLCEDSSFQLVTVIRRWAGKPWEGSRLTRLLERAARVALRKC
PQLNVGYLSSDFNNHPLAHLMNDGSVHRRQIEREASAFRDVSGLSPEKVLEKIGRDQIHILVNLNGYTRGARNEI
FAARPAPIQMSFMGFAGSLGAEWCDYILADSTTVPPETLRPWRRNVSIEDVLNDNTECSEGQWVYSENVIFCRST
FFCCDHAQSSGQGEKILTWDGEKRRRWELRRQLFPSMPDDTVILGNFNQLYKIDPTIFRSWLRILSRVPNAILWL
LRFPEPGEINLRATAESWAGPEVAKRLVFTDVAPKDQHILRARVCDLFLDTPESRRY*
Coding >Ophcf2|06070
ATGCTACTCGGTGGTTGTCTTCAATATGGTTTGGGATATTATGGGAGCGCACTCCAGTGGTTCTCGAGGATTCTA
GAGTTAGACACGAGTCACGTCGAAGCCATGACGAATATGGCGGCTACGCTGTTTTGTGTGAACCGCCAAATGTAC
GAGCGTGCCGTCTTGTGTGACGGAACATTTGACATTGCTCTGACGAACCTCGCCAACGCCGTCAAGGACAAGGGC
CGCATCGTTGACGCTATCGCATATTACCGTCGGGCGCTGTGTTCCAATCCGGAATTTGACGAGGCCGTGTGTGGC
CTCTTCATAGCCTTGAATTTTGTGTGTGATTGGCGAGGCCGTGGAGGTGTGCTGCTGACTTCAGGCGACTACGAC
AGATGGCACGTTGATGATGACGGCAAAATACTCGATGCTCGGAAACAAAGCGGCGCGCGGGGCTTAGCCATGCGC
GTTGTGGGCATTGTTGCTCATCAGCTTCGAGATGCGTCTTCTTGGGGCCAACATACTCTTCGAGAGCCAGTCATC
CAAGCCGTTGAACAGCAGCTTCGGCACCTCTGCGAAGACTCATCCTTCCAGCTCGTTACTGTTATCCGGCGATGG
GCAGGCAAGCCATGGGAAGGTTCGCGATTGACCCGTCTGTTGGAGCGAGCTGCTCGAGTGGCTCTCCGCAAGTGC
CCGCAATTGAATGTTGGCTATCTGTCGTCGGATTTCAATAACCACCCCTTGGCTCATCTAATGAACGACGGATCC
GTTCATAGACGACAGATTGAAAGAGAGGCTTCGGCTTTTCGCGATGTCAGCGGCTTGTCGCCCGAAAAGGTGTTA
GAGAAAATTGGACGTGATCAGATACACATCTTGGTGAATCTCAACGGCTACACCAGAGGTGCTCGAAACGAAATC
TTTGCTGCCAGACCAGCGCCAATACAGATGTCTTTCATGGGCTTCGCGGGCAGCCTGGGTGCCGAGTGGTGCGAC
TACATACTGGCCGATTCAACGACCGTGCCACCTGAAACCTTACGCCCGTGGCGTAGAAACGTCAGCATTGAAGAC
GTGCTAAACGATAATACCGAATGCAGCGAGGGTCAGTGGGTGTACTCTGAGAATGTCATCTTTTGTCGCAGCACA
TTTTTCTGCTGCGATCACGCTCAATCAAGTGGACAGGGTGAGAAGATCTTGACTTGGGATGGAGAGAAGAGAAGG
AGATGGGAGCTGCGCCGACAATTGTTCCCGAGTATGCCTGACGATACCGTCATCTTGGGTAACTTCAATCAACTG
TACAAAATCGATCCAACGATATTCCGGTCATGGCTTCGAATCCTGTCACGCGTTCCCAATGCCATACTCTGGCTT
CTGCGATTTCCAGAGCCAGGCGAGATCAACTTGCGGGCAACGGCCGAGTCATGGGCTGGGCCTGAGGTAGCGAAG
CGCCTTGTCTTCACAGATGTGGCACCGAAGGACCAGCACATACTGCGTGCTCGCGTATGCGATCTGTTCCTCGAC
ACTCCTGAATCACGCCGCTACTGA
Transcript >Ophcf2|06070
ATGCTACTCGGTGGTTGTCTTCAATATGGTTTGGGATATTATGGGAGCGCACTCCAGTGGTTCTCGAGGATTCTA
GAGTTAGACACGAGTCACGTCGAAGCCATGACGAATATGGCGGCTACGCTGTTTTGTGTGAACCGCCAAATGTAC
GAGCGTGCCGTCTTGTGTGACGGAACATTTGACATTGCTCTGACGAACCTCGCCAACGCCGTCAAGGACAAGGGC
CGCATCGTTGACGCTATCGCATATTACCGTCGGGCGCTGTGTTCCAATCCGGAATTTGACGAGGCCGTGTGTGGC
CTCTTCATAGCCTTGAATTTTGTGTGTGATTGGCGAGGCCGTGGAGGTGTGCTGCTGACTTCAGGCGACTACGAC
AGATGGCACGTTGATGATGACGGCAAAATACTCGATGCTCGGAAACAAAGCGGCGCGCGGGGCTTAGCCATGCGC
GTTGTGGGCATTGTTGCTCATCAGCTTCGAGATGCGTCTTCTTGGGGCCAACATACTCTTCGAGAGCCAGTCATC
CAAGCCGTTGAACAGCAGCTTCGGCACCTCTGCGAAGACTCATCCTTCCAGCTCGTTACTGTTATCCGGCGATGG
GCAGGCAAGCCATGGGAAGGTTCGCGATTGACCCGTCTGTTGGAGCGAGCTGCTCGAGTGGCTCTCCGCAAGTGC
CCGCAATTGAATGTTGGCTATCTGTCGTCGGATTTCAATAACCACCCCTTGGCTCATCTAATGAACGACGGATCC
GTTCATAGACGACAGATTGAAAGAGAGGCTTCGGCTTTTCGCGATGTCAGCGGCTTGTCGCCCGAAAAGGTGTTA
GAGAAAATTGGACGTGATCAGATACACATCTTGGTGAATCTCAACGGCTACACCAGAGGTGCTCGAAACGAAATC
TTTGCTGCCAGACCAGCGCCAATACAGATGTCTTTCATGGGCTTCGCGGGCAGCCTGGGTGCCGAGTGGTGCGAC
TACATACTGGCCGATTCAACGACCGTGCCACCTGAAACCTTACGCCCGTGGCGTAGAAACGTCAGCATTGAAGAC
GTGCTAAACGATAATACCGAATGCAGCGAGGGTCAGTGGGTGTACTCTGAGAATGTCATCTTTTGTCGCAGCACA
TTTTTCTGCTGCGATCACGCTCAATCAAGTGGACAGGGTGAGAAGATCTTGACTTGGGATGGAGAGAAGAGAAGG
AGATGGGAGCTGCGCCGACAATTGTTCCCGAGTATGCCTGACGATACCGTCATCTTGGGTAACTTCAATCAACTG
TACAAAATCGATCCAACGATATTCCGGTCATGGCTTCGAATCCTGTCACGCGTTCCCAATGCCATACTCTGGCTT
CTGCGATTTCCAGAGCCAGGCGAGATCAACTTGCGGGCAACGGCCGAGTCATGGGCTGGGCCTGAGGTAGCGAAG
CGCCTTGTCTTCACAGATGTGGCACCGAAGGACCAGCACATACTGCGTGCTCGCGTATGCGATCTGTTCCTCGAC
ACTCCTGAATCACGCCGCTACTGA
Gene >Ophcf2|06070
ATGCTACTCGGTGGTTGTCTTCAATATGGTTTGGGATATTATGGGAGCGCACTCCAGTGGTTCTCGAGGATTCTA
GAGTTAGACACGAGGTAAATCCTGGCTTGTACATGCCACAGTGGCTAAGACCCTGACTTTTTGGCAGTCACGTCG
AAGCCATGACGAATATGGCGGCTACGCTGTTTTGTGTGAACCGCCAAGTTGAGGCTGAACAGCTTTGGCTTCGAG
CTGTCGAATTACGACCCAGCTGCCTCGAAGCTTCGGAGCATCTCATCTGCCTCTTGTATAGAAGCCGTAGCGAAG
AAGCTGTTGAGGTAATTTCTTACGTACAGCGGTCCCTGAGGATACCATTGAATTTTTCCAGCAGTCCGGGAAGCT
CCCTGAGCGATGGCCATTGTTCAAGCGGGTACACGCTTCCCGCAAGCGAAAATGGGAGGATTGTCGCCCTCCTGC
ATGCCAAGGGAACAATGCTTTACAGTCAGAGAAAAGTCGAGAAAGCCTCTGAGGCATTTGAAGAGGCTGTCTTGA
TCAGTACTGGGCGACGCTTCCGAGGCTTGCACGATCTGACAAGACACATCCAGTTTGTATTGTCACATAAAAGCT
CCGATGCTAGTCGTGACGATCAACAAACCCCCCTACCTTCAATGCTCCCCCCTGAGATGGCCCGACGCACAGCAC
AGCTCGTATTTGCCGCAGACGGGGACTTGCCAGGGTTGCTACTCGTACGCAATGGCATCGCTAAAAAGCAGGCCA
TACAAACCACAAGTAACTCGCTCCTGTCGCTCGCCAAGATCCTCCAAGATGCTGTTTCCAATGGTAACGCCCATC
CTGGTGTCTCGCGGGGAAGTACCTCGAGCGTCGGAGACATTCTGGCACTCTATTATCTGTCGTTGTCGCTTCAAG
AAAGCCCCTCGACAGCGAACAATGTCGGTATACTTCTCGCCGGGATTCAGCAGACGAGCTCTTCCCCCCCTCAGA
CGATTTCAAGAGATCTCAGTTCATCGTCTTTGCACAGCGTTTACCCTGGAAGCGGAATGGCGTTGGCCATGGCCT
ACTACAACTATGGCTTGCGACTCGATCCCAATCATGTCCATCTGCACACAAATCTTGGCAGCCTCCTGAAGGACA
TGGGTCAGCTGGACCGTGCGATCCAGATGTACGAGCGTGCCGTCTTGTGTGACGGAACATTTGACATTGCTCTGA
CGAACCTCGCCAACGCCGTCAAGGACAAGGGCCGCATCGTTGACGCTATCGCATATTACCGTCGGGCGCTGTGTT
CCAATCCGGAATTTGACGAGGCCGTGTGTGGCCTCTTCATAGCCTTGAATTTTGTGTGTGATTGGCGAGGCCGTG
GAGGTGTGCTGCTGACTTCAGGCGACTACGACAGATGGCACGTTGATGATGACGGCAAAATACTCGATGCTCGGA
AACAAAGCGGCGCGCGGGGCTTAGCCATGCGCGTTGTGGGCATTGTTGCTCATCAGCTTCGAGATGCGTCTTCTT
GGGGCCAACATACTCTTCGAGAGCCAGTCATCCAAGCCGTTGAACAGCAGCTTCGGCACCTCTGCGAAGACTCAT
CCTTCCAGCTCGTTACTGTTATCCGGCGATGGGCAGGCAAGCCATGGGAAGGTTCGCGATTGACCCGTCTGTTGG
AGCGAGCTGCTCGAGTGGCTCTCCGCAAGTGGTATCTGGATATCAACTCTCGTGGCAGGGATCTTTCGTCTCTCG
CTTATGTTCGGGTGAGGCTTCCACCCGGCCTTGCAGTTCCGACGGCACCGACAGTGCTTCCATTTCACACCTTCA
CATGCCCATTCGAGGCAAGCCAAGTACGAGCAATAGCCCGAAGCAATGCGTTGCGAATTTCCTGCTCAACACTAC
GATCGTCATGGCTCCCTTCCACTCTATTCCCGCCGCCTCCACCGCCCAGCCCGCAATTGAATGTTGGCTATCTGT
CGTCGGATTTCAATAACCACCCCTTGGCTCATCTGTAAGCGTCTTCTTTACCAGAACTTGTAATGCCACTCACCA
GATTGATCAGAATGAAGTCTGTCTTTGGATTTCACAATCCACGCCGTGTACGTTCTTTTTGCTACGCTACAACGG
CAAGCGACGGATCCGTTCATAGACGACAGATTGAAAGAGAGGCTTCGGCTTTTCGCGATGTCAGCGGCTTGTCGC
CCGAAAAGGTGTTAGAGAAAATTGGACGTGATCAGATACACATCTTGGTGAATCTCAACGGCTACACCAGAGGTG
CTCGAAACGAAATCTTTGCTGCCAGACCAGCGCCAATACAGATGTCTTTCATGGGCTTCGCGGGCAGCCTGGGTG
CCGAGTGGTGCGACTACATACTGGCCGATTCAACGACCGTGCCACCTGAAACCTTACGCCCGTGGCGTAGAAACG
TCAGCATTGAAGACGTGCTAAACGATAATACCGAATGCAGCGAGGGTCAGTGGGTGTACTCTGAGAATGTCATCT
TTTGTCGCAGCACATTTTTCTGCTGCGATCACGCTCAATCAAGTGGACAGGGTGAGAAGATCTTGACTTGGGATG
GAGAGAAGAGAAGGAGATGGGAGCTGCGCCGACAATTGTTCCCGAGTATGCCTGACGATACCGTCATCTTGGGTA
ACTTCAATCAACTGTACAAAGTGAGCCTTATCTTGCTTGGTTCACTAGCATAGAACGAGACTCTCAGGACTGACA
GGACGCGTTTCTTCGAATTAAGATCGATCCAACGATATTCCGGTCATGGCTTCGAATCCTGTCACGCGTTCCCAA
TGCCATACTCTGGCTTCTGCGATTTCCAGAGCCAGGCGAGATCAACTTGCGGGCAACGGCCGAGTCATGGGCTGG
GCCTGAGGTAGCGAAGCGCCTTGTCTTCACAGATGTGGCACCGAAGGACCAGCACATACTGCGTGCTCGCGTATG
CGATCTGTTCCTCGACACTCCTGAATGTAACGCACATACAACGGCCGCGGATGTATTGTGGTCAAGCACGCCGCT
ACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail