Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06069
Gene name
Locationscaffold_07:941713..944339
Strand+
Gene length (bp)2626
Transcript length (bp)1443
Coding sequence length (bp)1443
Protein length (aa) 481

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12471 GTP_CH_N GTP cyclohydrolase N terminal 1.0E-87 66 258
PF00925 GTP_cyclohydro2 GTP cyclohydrolase II 4.6E-18 290 432

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Nuclear export signal 0.6919 0.4568 0.0123 0.1876 0.1865 0.1485 0.1156 0.1979 0.2275 0.0574

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5281
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1968
Ophiocordyceps australis map64 (Brazil) OphauB2|5489
Ophiocordyceps camponoti-floridani Ophcf2|06069 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6593
Ophiocordyceps kimflemingae Ophio5|7556
Ophiocordyceps subramaniannii Hirsu2|4672

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06069
MDQSLRSPDVLSTLHTVTSNSHSTSLENALSSEAPGKDSIEIPSMIGTNPTSQVVSHPNKSGYASRIILTTYPKQ
IGIDPIGLDWGNPDPEKRGPVVVSRSPSTIRRRNAIGAHGGSYSIYYALAVASKELNIDHRPDFTNTEPAVELGP
FPQWGKREKIVAMDAWGHKVPWTYKAIMERENIDLRPTIAITRAHMKLAELEDSVKNGRLVPDGKVCLNELGELS
VTKFAVEPVWYLPGVAERFGIDEATLRRSLFENTGGSYPELITRGDIKVFLPPIGGLTVYCFGDPAKMSDESARL
TLRIHDECNGSDVFGSDICTCRPYLIFGIEEAVKEAQNGGSGVVIYFRKEGRALGEVTKVLVYNARKRGADRASD
YFTRTENIAGIKDMRFQALMPDILHWLGIKKIDRMLSMSNMKYDAIVKQGIPIYERVELPEDLMPADSRVEIDAK
ITAGYFTAGKRLTAEELKSVQGRIWDDIHH*
Coding >Ophcf2|06069
ATGGATCAATCTTTGAGAAGCCCTGACGTGCTCAGTACTCTTCATACCGTGACGTCCAATTCGCATTCGACATCT
CTTGAAAATGCTCTAAGCTCGGAAGCTCCTGGCAAAGATTCTATCGAGATCCCCTCAATGATAGGCACCAACCCT
ACGTCTCAAGTAGTATCACATCCTAATAAATCAGGATATGCCTCTCGAATTATACTCACAACATATCCCAAGCAA
ATTGGCATAGACCCAATTGGCCTGGATTGGGGTAATCCCGATCCCGAGAAACGGGGCCCTGTCGTTGTCTCGAGA
TCACCGTCGACAATTCGCCGTCGCAATGCCATCGGAGCGCACGGAGGCTCCTATTCCATCTATTACGCCCTTGCT
GTTGCTAGCAAGGAATTGAATATTGACCATAGGCCCGACTTCACAAATACCGAGCCAGCTGTCGAACTTGGTCCA
TTCCCTCAGTGGGGAAAACGTGAAAAGATTGTGGCCATGGATGCATGGGGCCATAAGGTTCCTTGGACCTACAAA
GCCATTATGGAGCGTGAAAACATTGATCTACGACCAACGATCGCCATTACCCGGGCGCATATGAAGTTGGCGGAG
TTGGAAGATAGCGTAAAGAACGGGCGATTGGTGCCAGACGGCAAGGTTTGCCTAAACGAGCTTGGCGAGCTCTCC
GTCACGAAATTCGCCGTTGAGCCGGTCTGGTACCTGCCCGGTGTTGCAGAGAGGTTCGGGATTGACGAAGCAACT
CTTCGCCGATCTTTGTTTGAGAATACGGGTGGCAGCTATCCAGAATTGATCACTCGGGGGGACATCAAAGTCTTT
CTGCCGCCTATAGGGGGCTTGACCGTGTATTGCTTCGGAGACCCTGCCAAGATGTCGGACGAGTCAGCTCGGTTG
ACTCTCAGGATCCACGACGAGTGCAACGGAAGTGATGTGTTTGGATCAGACATCTGCACCTGCCGACCGTATCTT
ATTTTTGGAATAGAGGAGGCAGTCAAGGAGGCTCAGAACGGAGGTAGCGGTGTCGTCATCTACTTCAGGAAAGAG
GGTAGAGCCCTTGGAGAAGTTACTAAGGTTCTGGTTTACAACGCGCGGAAGCGCGGCGCTGATAGAGCCTCAGAC
TACTTCACAAGGACAGAGAATATTGCTGGCATTAAAGACATGCGTTTTCAGGCATTGATGCCGGATATTCTACAT
TGGCTAGGCATCAAGAAAATCGATAGGATGCTCAGCATGAGCAATATGAAGTACGATGCCATTGTCAAACAAGGC
ATACCCATTTATGAAAGAGTTGAGCTGCCGGAAGACTTGATGCCGGCCGATTCTCGAGTCGAGATCGATGCAAAG
ATAACAGCCGGCTATTTCACGGCTGGTAAGCGACTCACGGCCGAGGAACTGAAATCAGTTCAAGGACGTATATGG
GATGACATACACCACTGA
Transcript >Ophcf2|06069
ATGGATCAATCTTTGAGAAGCCCTGACGTGCTCAGTACTCTTCATACCGTGACGTCCAATTCGCATTCGACATCT
CTTGAAAATGCTCTAAGCTCGGAAGCTCCTGGCAAAGATTCTATCGAGATCCCCTCAATGATAGGCACCAACCCT
ACGTCTCAAGTAGTATCACATCCTAATAAATCAGGATATGCCTCTCGAATTATACTCACAACATATCCCAAGCAA
ATTGGCATAGACCCAATTGGCCTGGATTGGGGTAATCCCGATCCCGAGAAACGGGGCCCTGTCGTTGTCTCGAGA
TCACCGTCGACAATTCGCCGTCGCAATGCCATCGGAGCGCACGGAGGCTCCTATTCCATCTATTACGCCCTTGCT
GTTGCTAGCAAGGAATTGAATATTGACCATAGGCCCGACTTCACAAATACCGAGCCAGCTGTCGAACTTGGTCCA
TTCCCTCAGTGGGGAAAACGTGAAAAGATTGTGGCCATGGATGCATGGGGCCATAAGGTTCCTTGGACCTACAAA
GCCATTATGGAGCGTGAAAACATTGATCTACGACCAACGATCGCCATTACCCGGGCGCATATGAAGTTGGCGGAG
TTGGAAGATAGCGTAAAGAACGGGCGATTGGTGCCAGACGGCAAGGTTTGCCTAAACGAGCTTGGCGAGCTCTCC
GTCACGAAATTCGCCGTTGAGCCGGTCTGGTACCTGCCCGGTGTTGCAGAGAGGTTCGGGATTGACGAAGCAACT
CTTCGCCGATCTTTGTTTGAGAATACGGGTGGCAGCTATCCAGAATTGATCACTCGGGGGGACATCAAAGTCTTT
CTGCCGCCTATAGGGGGCTTGACCGTGTATTGCTTCGGAGACCCTGCCAAGATGTCGGACGAGTCAGCTCGGTTG
ACTCTCAGGATCCACGACGAGTGCAACGGAAGTGATGTGTTTGGATCAGACATCTGCACCTGCCGACCGTATCTT
ATTTTTGGAATAGAGGAGGCAGTCAAGGAGGCTCAGAACGGAGGTAGCGGTGTCGTCATCTACTTCAGGAAAGAG
GGTAGAGCCCTTGGAGAAGTTACTAAGGTTCTGGTTTACAACGCGCGGAAGCGCGGCGCTGATAGAGCCTCAGAC
TACTTCACAAGGACAGAGAATATTGCTGGCATTAAAGACATGCGTTTTCAGGCATTGATGCCGGATATTCTACAT
TGGCTAGGCATCAAGAAAATCGATAGGATGCTCAGCATGAGCAATATGAAGTACGATGCCATTGTCAAACAAGGC
ATACCCATTTATGAAAGAGTTGAGCTGCCGGAAGACTTGATGCCGGCCGATTCTCGAGTCGAGATCGATGCAAAG
ATAACAGCCGGCTATTTCACGGCTGGTAAGCGACTCACGGCCGAGGAACTGAAATCAGTTCAAGGACGTATATGG
GATGACATACACCACTGA
Gene >Ophcf2|06069
ATGGATCAATCTTTGAGAAGCCCTGACGTGCTCAGTACTCTTCGTGAGTTGCAGAAAGGCCAATCCCAACTCTGG
GCAGTCGTACAATCCATCGCAGACAAGCTTGGTTCAGATACCGTGACGTCCAATTCGCATTCGACATCTCTTGAA
AATGCTCTAAGCTCGGAAGCTCCTGGCAAAGATTCTATCGAGATCCCCTCAATGATAGGCACCAACCCTACGTCT
CAAGTAGTATCACATCCTAATAAATCAGGATATGCCTCTCGAATTATACTCACGTGGGATGCCTCCACTTCCGTC
GCCTCGTACATCTTTTTGTAGCCTTGTCGCTAAGCTGATGACTTCTGCAGAACATATCCCAAGCAAATTGGCATA
GACCCAATTGGCCTGGATTGGGGTAATCCCGATCCCGAGAAACGGGGCCCTGTCGTTGTCTCGAGATCACCGTCG
ACAATTCGCCGTCGCAATGGTAAGCATTGCGGGACACTTCCATCATATTCACGTCTTTTGAGAGGACTGACATTG
TCTTACTCTTGATAAGCCATCGGAGGTTGGTCTCGCTATGGAATCTTGACAGGGTGCCTAATGCTAACAAACGTG
TCAAGCGCAGTTCGTGACTATCTTTGACCTGTGCAGGACGAATTGCTAAATCTGACGTTGCTCTCACAGCGGAGG
CTCCTATTCCATCTATTACGCCCTTGCTGTTGCTAGCAAGGAATTGAATATTGACCATAGGTGAGTTCCGCGAGA
AACATTTCAATGATTGGTCTCCGATGCTAAAAAAACCCCGTTAGGCCCGACTTCACAAATACCGAGCCAGCTGTC
GAACTTGGTCCATTCCCTCAGTGGGGAAAACGTGAAAAGATTGTGGCCATGGATGCATGGGGCCATAAGGTTCCT
TGGACCTACAAAGCCATTATGGAGCGTGAAAACAGTACGACTGCGGCCGATGTACGTAATTATTCAAAGCTGACA
TGCAACCAGTTGATCTACGACCAACGATCGCCATTACCCGGGCGCATATGAAGGTATGTTAGCGTCGAAGTATGA
AGTAGATATTCGTGCTTGCGTCTAACTTGACGTTATTCAGTTGGCGGAGTTGGAAGATAGCGTAAAGAACGGGCG
ATTGTGCGATGATGACATCCTGGCTTCAATATCGCTCCAGTCTGGCTGATATTACAAAGGGTGCCAGACGGCAAG
GTTTGCCTAAACGAGCTTGGCGAGCTCTCCGTCACGAAATTCGCCGTTGAGCCGGTCAGAGCAATCGACAATTCG
TTCTTTGTACTCAACGACTGATATTCTATTGGACAGGTCTGGTACCTGCCCGGTGTTGCAGAGAGGTTCGGGATT
GGTGAGCACCCTGAGCTTTATTGGTATACTTCTCTTGCTCATACTCGTGGCAGACGAAGCAACTCTTCGCCGATC
TTTGTTTGAGAATACGGGTGGCAGCTATCCAGAAGTATGTTCCCGAGACGATTGGGCGTTCTTCACCCCTTTACT
AACCAGCTGAGAGTTGATCACTCGGGGGGACATCAAAGTCTTTCTGCCGCCTATAGGTGCTTTACCCCACCTTCT
CATTGACTACAAGGTAACCAATGTGACTGTGGCTGACCCTTTTAGGGGGCTTGACCGTGTATTGCTTCGGAGACC
CTGCCAAGATGTCGGACGAGTCAGCTCGGTTGACTCTCAGGATCCACGACGAGGTTTGTCGTCCAAATGCAACTC
ACGAAGTCACTACTCACGTCAAATGCAGTGCAACGGAAGTGATGTGTTTGGATCAGACATCTGCACCTGCCGACC
GTATCTTATTTTTGGAATAGAGGAGGCAGTCAAGGAGGCTCAGAACGGAGGTAGCGGTGTCGTCATCTACTTCAG
GAAAGAGGGTAGAGCCCTTGGAGAAGTTACTAAGGTTCGTTTAAATACCACCTGGAATGGGCGCCACTATCACGA
GCCACCATTACTAATAAAAATCGACAGTATTGTACGGTCTAGACTCTTTGGCCCTCGGCGGTAGCATGAAGCTAA
CTAAGACAAAGTGGTTTACAACGCGCGGAAGCGCGGCGCTGATAGAGCCTCAGACTACTTCACAAGGACAGAGAA
TATTGCTGGCATTAAAGACATGCGTTTTCAGGCATTGATGCCGGATATTCTACATTGGCTAGGCATCAAGAAAAT
CGATAGGATGCTCAGCATGAGCAAGTATGGTTTCCAACAATCAACACTTATGGGATTCGACTAACATTGCTATGA
CTAGTATGAAGTACGATGCCATTGTCAAACAAGGGTGGGTTAGTCTGGTTGGAATCCGGCAGTTGGAAGACTAAA
ACTTTATCAGCATACCCATTTATGAAAGAGTTGAGCTGCCGGAAGACTTGATGCCGGCCGATTCTCGAGTCGAGA
TCGATGCAAAGATAACAGCCGGTAAGCGATGAGCCGGGAACGATAGCCTTAAAATTGCTAAACGCCGTATTTCTC
TAAGGCTATTTCACGGCTGGTAAGCGACTCACGGCCGAGGAACTGAAATCAGTTCAAGGACGTATATGGGATGAG
TGAGTCGTTGATTTCTTTCTAACAATCCCCTCGCGATGGTCTGCGGAGCCTAACTCTGCGCAGCATACACCACTG
A

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail