Fungal Genomics

at Utrecht University

General Properties

Protein IDOphcf2|06067
Gene name
Locationscaffold_07:900545..901510
Strand+
Gene length (bp)965
Transcript length (bp)546
Coding sequence length (bp)546
Protein length (aa) 182

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04161 Arv1 Arv1-like family 3.2E-46 3 138
PF04161 Arv1 Arv1-like family 1.9E-08 133 171

GO

GO Term Description Terminal node
GO:0032366 intracellular sterol transport Yes
GO:0015918 sterol transport No
GO:0051641 cellular localization No
GO:0051179 localization No
GO:0046907 intracellular transport No
GO:0071702 organic substance transport No
GO:0015850 organic hydroxy compound transport No
GO:0006869 lipid transport No
GO:0008150 biological_process No
GO:0051649 establishment of localization in cell No
GO:0006810 transport No
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0032365 intracellular lipid transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 132 154 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in: Will et al., G3, 2020

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Fungus Fungus in pure culture 151.54 83.64 219.43
Alive In ants, during behavior modification 173.80 96.52 251.09
Dead In ants, recently dead 167.60 93.64 241.55

Differential expression

Label1 Label2 Q-value Significant difference
Alive Fungus 0.534640 no
Alive Dead 0.863128 no
Dead Fungus 0.655760 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophcf2|06067
MPICIECRHYVKTLWTKYSGAGDQSSGHNIRLTVCRQCGRFCDKYVEHDFIVLFIDLVLIKPQVYRHLLHNTLMR
ELDGFDPSIIRLGVLLLLFDVYLTWARIEKQTVPTASPSESNLGRLARQPIVLQYMFFLLLSLLVSSSTKLFPIL
MVIWEYDVPAAARSLGWALLLVQHPDGLWAD*
Coding >Ophcf2|06067
ATGCCTATCTGTATTGAATGTCGACATTATGTGAAGACTCTCTGGACCAAGTACTCCGGTGCTGGTGACCAGTCA
TCCGGCCACAACATTCGATTGACTGTTTGCCGACAATGTGGTCGGTTCTGCGACAAATACGTGGAGCACGACTTC
ATCGTCTTGTTCATTGACCTTGTGTTGATCAAGCCGCAAGTCTACCGCCATCTTCTACACAACACCCTCATGCGC
GAATTGGATGGCTTTGATCCGTCAATCATACGTCTTGGGGTTTTACTACTACTTTTCGATGTCTACCTCACGTGG
GCTCGCATTGAGAAGCAGACAGTACCCACTGCGTCTCCTAGCGAAAGCAACCTGGGTCGACTTGCGCGTCAGCCA
ATTGTGTTGCAGTATATGTTCTTTTTGCTGCTGTCCCTGCTTGTCTCGTCCTCTACCAAACTTTTCCCCATTTTG
ATGGTCATCTGGGAATATGACGTCCCCGCCGCCGCACGATCACTGGGCTGGGCGCTTTTGCTGGTGCAGCATCCC
GATGGGCTATGGGCCGATTAG
Transcript >Ophcf2|06067
ATGCCTATCTGTATTGAATGTCGACATTATGTGAAGACTCTCTGGACCAAGTACTCCGGTGCTGGTGACCAGTCA
TCCGGCCACAACATTCGATTGACTGTTTGCCGACAATGTGGTCGGTTCTGCGACAAATACGTGGAGCACGACTTC
ATCGTCTTGTTCATTGACCTTGTGTTGATCAAGCCGCAAGTCTACCGCCATCTTCTACACAACACCCTCATGCGC
GAATTGGATGGCTTTGATCCGTCAATCATACGTCTTGGGGTTTTACTACTACTTTTCGATGTCTACCTCACGTGG
GCTCGCATTGAGAAGCAGACAGTACCCACTGCGTCTCCTAGCGAAAGCAACCTGGGTCGACTTGCGCGTCAGCCA
ATTGTGTTGCAGTATATGTTCTTTTTGCTGCTGTCCCTGCTTGTCTCGTCCTCTACCAAACTTTTCCCCATTTTG
ATGGTCATCTGGGAATATGACGTCCCCGCCGCCGCACGATCACTGGGCTGGGCGCTTTTGCTGGTGCAGCATCCC
GATGGGCTATGGGCCGATTAG
Gene >Ophcf2|06067
ATGCCTATCTGTATTGAATGTCGACATTATGTGAAGACTCTCTGGACCAAGTACTCCGGTGCTGGTGACCAGTCA
TCCGGCCACAACATTCGATTGACTGTTTGCCGACAATGTGGTCGGTTCTGCGACAAATACGTGGAGCACGACTTC
ATCGTCTTGTTCATTGACCTTGTGTTGATCAAGCCGCAAGCATGTTGCCTCTCTAGCGATTTTTTGAAGACTGCT
GATGTTCTAACTCCTCGTTGAAGGTCTACCGCCATCTTCTACACAACACCCTCATGCGCGAATTGGATGGCTTTG
ATGTAAGTTACTTCACTACATGCGCGATCCGACAAATCTTCCACTTTCATACCCTCTTGTCAAACATTCCAGGCA
CCAACTGTCTTCTGACCGAAGTTTCCCGAGGCGGTAGCCGTCAATCATACGTCTTGGGGTTTTACTACTACTTTT
CGATGTCTACCTCACGTGGGCTCGCATTGAGAAGCAGACAGTACCCACTGCGTCTCCTAGCGAAAGCAACCTGGG
TCGACTTGCGCGTCAGCCAATTGTGTTGCAGTATATGTTCTTTTGTCAGTCTTCGTCATAGGTATTGCATAGGAT
ATTCATGTTCATCACTCACTACTTGATAGTGCTGCTGTGTACGCTCTCGACCACGGCTTTTCACGTCAGCATTCG
TTTCTTGGCATCTTCACCATATTCGCCACTACTCTCTTTGGGTATAATGGCTCGACGAACGAGACCCAATTCTAT
TTCGACAGCCCTGCTTGTCTCGTCCTCTACCAAACTTTTCCCCATTTTGATGGTCATCTGGGAATATGACGTCCC
CGCCGCCGCACGATCACTGGGCTGGGCGGTAGTAGCAAATAATGTCGAGGCGTTGCGAATTCTCCTAGACTGCAG
ATATCACACAGCTTGCATACTAGCTTTTGCTGGTGCAGCATCCCGATGGGCTATGGGCCGATTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail